CAZyme Information: QRC95428.1

Basic Information

• Species: Parastagonospora nodorum
• Lineage: Ascomycota; Dothideomycetes; ; Phaeosphaeriaceae; Parastagonospora; Parastagonospora nodorum
• CAZyme ID: QRC95428.1
• CAZy Family: CE1
• CAZyme Description: Glycoside hydrolase family 125 protein [Source:UniProtKB/TrEMBL;Acc:A0A7U2HYK9]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
477		53640.33	4.9634

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PnodorumSN15	17580	321614	132	17448

• Gene Location: location=CP069027:1570702-1572188(-)

Full Sequence      

MRPIAPCRTFRVQEIEDEIERLKNVIVDPDLFRLFQNSWPSTLDTTVGWHGWSNATTVAA
DGTIKEGMKEELTFLITGDIEAMWLRDSANQLQSYISVLKANSSLDSLASLFRGAINLQA
RYILSNPFCNAFQAPDESGIVRKSSQNSDTISPPYDYFRVFSCQWELDSVASFLQLSTDY
VTATGDFEFFQKSSNWTKAVDLILQTAESMMIDSYDDDGKWQHTPYTYCAPYGGTPINNC
NGSPHRGHIGLVRSFHRPSDDACIYQYLVPSNMMFSSALNTSSNIMSRIEPADGKLTSRM
REMATGINRGIVDHAIITDPKYGKIYAFEVDGYGSHISMDDPNVPSLLSAPFLSYTTVHD
PVYQNTRRKILSRDNPYFSRGPVITGLGSPHTWPGKAWPMANIMTILTSEDDAEIISNLK
MLLSSTSGLGLMHESVDSHQEGSYTRSWFSWANGLFGQVILDLEKRRPWVLEMSFQE

Enzyme Prediction     

No EC number prediction in QRC95428.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH125	28	461	5.9e-147	0.9975124378109452

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399660	Glyco_hydro_125	0.0	28	461	1	416	Metal-independent alpha-mannosidase (GH125). This family, which contains bacterial and fungal glycoside hydrolases, is also known as GH125. They function as metal-independent alpha-mannosidases, with specificity for alpha-1,6-linked non-reducing terminal mannose residues. Structurally this family is part of the 6 hairpin glycosidase superfamily.
226068	COG3538	4.17e-138	7	468	2	427	Meiotically up-regulated gene 157 (Mug157) protein (function unknown) [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRC95428.1|GH125	0.0	1	477	1	477
CAE6998365.1|GH125	1.11e-258	2	476	50	530
CBY01984.1|GH125	1.72e-248	2	473	45	516
QSZ30983.1|GH125	5.09e-177	1	476	52	518
APA07134.1|GH125	1.25e-169	1	476	47	516

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2P0V_A	5.78e-84	2	463	43	468	Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482],2P0V_B Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482]
3P2C_A	3.73e-81	2	463	21	450	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483],3P2C_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483]
3ON6_A	4.97e-81	2	463	23	448	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483],3ON6_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483]
3QPF_A	1.33e-69	12	462	8	421	Analysis of a New Family of Widely Distributed Metal-independent alpha-Mannosidases Provides Unique Insight into the Processing of N-linked Glycans, Streptococcus pneumoniae SP_2144 apo-structure [Streptococcus pneumoniae],3QPF_B Analysis of a New Family of Widely Distributed Metal-independent alpha-Mannosidases Provides Unique Insight into the Processing of N-linked Glycans, Streptococcus pneumoniae SP_2144 apo-structure [Streptococcus pneumoniae],3QRY_A Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Streptococcus pneumoniae SP_2144 1-deoxymannojirimycin complex [Streptococcus pneumoniae],3QRY_B Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Streptococcus pneumoniae SP_2144 1-deoxymannojirimycin complex [Streptococcus pneumoniae],3QSP_A Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Streptococcus pneumoniae SP_2144 non-productive substrate complex with alpha-1,6-mannobiose [Streptococcus pneumoniae],3QSP_B Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Streptococcus pneumoniae SP_2144 non-productive substrate complex with alpha-1,6-mannobiose [Streptococcus pneumoniae]
6RQK_A	3.83e-67	9	462	5	421	Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13],6RQK_B Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10449|MU157_SCHPO	7.91e-124	2	474	51	507	Meiotically up-regulated gene 157 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug157 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000063	0.000000

TMHMM  Annotations     

There is no transmembrane helices in QRC95428.1.