CAZyme Information: QRC95338.1

Basic Information

• Species: Parastagonospora nodorum
• Lineage: Ascomycota; Dothideomycetes; ; Phaeosphaeriaceae; Parastagonospora; Parastagonospora nodorum
• CAZyme ID: QRC95338.1
• CAZy Family: CBM87|CE18
• CAZyme Description: Glycosyltransferase family 24 protein [Source:UniProtKB/TrEMBL;Acc:A0A7U2HYI3]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1505		168832.00	4.8196

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PnodorumSN15	17580	321614	132	17448

• Gene Location: location=CP069027:1391740-1396458(-)

Full Sequence      

MWTPASLLGARGLFALSAVHHIGALASPSINVALRASFSPAPYLVELLETAADENGTAYY
PILDRVSQGYFDKYATEQDLYTAFVDLLHNDGHITEPEALASFEFALSVRSAAPRIEAHY
QFYNTSVEPSLLAEQTNACDIWISFGGKQYCSPQFTEPFGDIKSERTYELPFDRTLGNSS
ALPAILYADITAPQFKPWHDMLSKTAKEGKTSYRIRHKPSNKASKSPLVVNGYGVELQLK
RTDYIVIDDRQKDESQPSGQKPLVTGLDEDQEVADLKPLSKDEVSDLGVKAASFVMKSDQ
PMDTLLKLVQDFPKYSSIIAGQNVSESFLEEHTKNREFLLPTGFNMIWINGVQIPARDVN
PYSLLSHLRRERTLINGIRSQGLSAPDVVALLSHEAIAATQTQDEPQRYDFRDEIEGGNV
IMYLNDIEKDDRYESWPTDLRALLQRTFPGQLPSVRRDIHNAIVPIDFTSIDDVTTIVDT
ILSLVQRGIPLRWGLVPQILTDGALEQAKVIYYLQDAYGIAGVTSYLQDSLNNKNLASPD
KNAFASVIKDGQLVADREALELTEVLKSEEVLKRAEAAKQYLKRLAANVPNAPVFVNGVP
VAQTDEWLGVLSQRIGSDLRQIQQNVFNGVFNEDSWVPQFFLLQASARRNPFIVPENEKN
ITLINMAEFEQAHGENFGKMPRIKAAESASKSDWVHITVLGDFDSPSGLALLKSAATYRE
ENPNAEIVLIHNANADSERNTSDDLLKAFTESNGDFTTEALSALLDKTSDSRPVTEESKA
FWKSASPILEVFTLKPGQNAIIVNGRQVGPIPDDLEFSKDDIETLVTYETNKRTEPLSLA
LTDLDLTSKLSTPFDVAKIQSLVTLSTISDVPDGIFESASTLRMSKFNNWTTEHTAIIKG
DFDNAVFQIVASIDPATEQAQKWIPILKTLSDMNGVHLKLFLNPKQMLQELPIKRFYRYL
LDARPTFNEDGSTGSLEAEFSGIPKEALLNLGMDVPPPWLVAPEESIHDLDNIKLSTLPA
GKNINAIYGLESILIEGHSRDTTLGGQPPSGAEVVLATEKDPHYADTIIMANLGYFQFKT
NPGFYNIRLKTGRSQEIFSLDSAGPKGWAPQPGDETTEIALMSFQGATIFPRLSRKPGQE
MADVLTPDESLASELVGKGTEKVNKLLGKLGLNFDSQKVLDKGAELLGSKSKKKGTQADI
NIFSVASGHLYERMLNIMMLSVMKHTKHSVKFWFIEQFLSPSFKSFLPHMAAEYGFEYEL
VTYKWPHWLRSQTEKQREIWGYKILFLDVLFPLDLEKVIFVDADQIVRTDMYELVTHDLE
GAPYGFTPMGDSRTEMEGFRFWKTGYWANFLRGRPYHISALYVVDLVKFRQLAAGDRLRQ
QYHQLSADPNSLSNLDQDLPNNMQFNLPIHSLPQEWLWCETWCSDADLEKAKTIDLCNNP
MTKEPKLDRARRQIPEWNVYDEEVGALARRVKGEKAKEEAVVDVQAEEQVREKKEKDEER
RRDEL

Enzyme Prediction     

EC	2.4.1.-:29

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT24	1200	1447	1.5e-133	0.9959677419354839

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133054	GT8_HUGT1_C_like	0.0	1200	1447	1	248	The C-terminal domain of HUGT1-like is highly homologous to the GT 8 family. C-terminal domain of glycoprotein glucosyltransferase (UGT). UGT is a large glycoprotein whose C-terminus contains the catalytic activity. This catalytic C-terminal domain is highly homologous to Glycosyltransferase Family 8 (GT 8) and contains the DXD motif that coordinates donor sugar binding, characteristic for Family 8 glycosyltransferases. GT 8 proteins are retaining enzymes based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. The non-catalytic N-terminal portion of the human UTG1 (HUGT1) has been shown to monitor the protein folding status and activate its glucosyltransferase activity.
408203	Glyco_transf_24	0.0	1200	1467	1	268	Glucosyltransferase 24. This is the catalytic domain found in UDP-glucose:glycoprotein glucosyltransferase (UGGT). This domain belongs to glucosyltransferase 24 family (GT24) A-type domain. The GT domain displays the expected glycosyltransferase type A (GT-A) fold.
408201	Thioredoxin_14	1.10e-96	409	653	1	248	Thioredoxin-like domain. This is the third out of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).
408202	Thioredoxin_15	1.39e-66	665	863	1	203	Thioredoxin-like domain. This is the fourth TRXL(thioredoxin-like) domain found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).
132996	Glyco_transf_8	4.86e-59	1200	1447	1	246	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRC95338.1|GT24	0.0	1	1505	1	1505
CAE6999215.1|GT24	0.0	1	1497	1	1498
CBX94261.1|GT24	0.0	1	1505	1	1508
APA14047.1|GT24	0.0	4	1473	7	1459
AQQ13387.1|GT24	0.0	26	1474	24	1482

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MU1_A	0.0	26	1477	7	1457	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5MZO_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TRF_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
5NV4_A	0.0	26	1477	7	1457	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
5Y7O_A	0.0	29	1145	5	1123	Crystal structure of folding sensor region of UGGT from Thermomyces dupontii [Thermomyces dupontii],5Y7O_B Crystal structure of folding sensor region of UGGT from Thermomyces dupontii [Thermomyces dupontii]
6TRT_A	0.0	26	1477	7	1457	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS2_A	0.0	26	1477	7	1223	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_C Chain C, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_D Chain D, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09140|UGGG_SCHPO	1.26e-259	14	1478	7	1435	UDP-glucose:glycoprotein glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpt1 PE=1 SV=2
sp|Q09332|UGGG_DROME	9.51e-226	30	1471	30	1511	UDP-glucose:glycoprotein glucosyltransferase OS=Drosophila melanogaster OX=7227 GN=Uggt PE=1 SV=2
sp|Q9NYU2|UGGG1_HUMAN	1.58e-225	27	1475	44	1531	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=UGGT1 PE=1 SV=3
sp|Q6P5E4|UGGG1_MOUSE	2.80e-225	27	1467	44	1523	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Mus musculus OX=10090 GN=Uggt1 PE=1 SV=4
sp|Q9JLA3|UGGG1_RAT	1.57e-223	27	1467	44	1523	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Uggt1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.963457	0.036568

TMHMM  Annotations     

There is no transmembrane helices in QRC95338.1.