CAZyme Information: QRC94890.1

Basic Information

• Species: Parastagonospora nodorum
• Lineage: Ascomycota; Dothideomycetes; ; Phaeosphaeriaceae; Parastagonospora; Parastagonospora nodorum
• CAZyme ID: QRC94890.1
• CAZy Family: GT8
• CAZyme Description: Chitin-binding type-1 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A7U2HWV3]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
421		41927.29	8.0747

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PnodorumSN15	17580	321614	132	17448

• Gene Location: location=CP069027:583695-585200(-)

Full Sequence      

MRSSLPALLLLLVPFGTTALRSVVSKDATCGGTKGYTCLGSKWGNCCSQYNWCGSTTAYC
GKGCNSEFGACANDGTTISSSVVIVSSSTRASTIPVASSQPVSTDARCGPSFGGKTCQGS
RWGNCCSQYSYCGSTSDYCSATTCRRGFGQCNSPGSSSVRSSSTLAPSRLSSVISSSSPS
SSSSVAQSSSTPLPSSAVSSTLATSSASGSLSLSLSTVQTQTSSASSTSSPSSASISSDP
SMLSASSATPSSESASPVAPSGTPEPPTSSAAPSSTPEPSTNSVTPSSTPEPSTSSAAPL
STPIRSAIPSSTPSTPACRFTPAPPTCNNYNGDLSNVCPANDMSCISGYQIRCNVVPQAN
LLGLPIFVANAAACAASCTAASCGAAAFNIQNGRGVCARYTTNIVGYSVAAGYTAFLRLC
T

Enzyme Prediction     

EC	-	-

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
211316	ChtBD1_1	1.56e-13	29	71	1	43	Hevein or type 1 chitin binding domain; filamentous ascomycete subfamily. Hevein or type 1 chitin binding domain (ChtBD1), a lectin domain found in proteins from plants and fungi that bind N-acetylglucosamine, plant endochitinases, wound-induced proteins such as hevein, a major IgE-binding allergen in natural rubber latex, and the alpha subunit of Kluyveromyces lactis killer toxin. This domain is involved in the recognition and/or binding of chitin subunits; it typically occurs N-terminal to glycosyl hydrolase domains in chitinases, together with other carbohydrate-binding domains, or by itself in tandem-repeat arrangements.
211316	ChtBD1_1	4.09e-08	107	152	1	44	Hevein or type 1 chitin binding domain; filamentous ascomycete subfamily. Hevein or type 1 chitin binding domain (ChtBD1), a lectin domain found in proteins from plants and fungi that bind N-acetylglucosamine, plant endochitinases, wound-induced proteins such as hevein, a major IgE-binding allergen in natural rubber latex, and the alpha subunit of Kluyveromyces lactis killer toxin. This domain is involved in the recognition and/or binding of chitin subunits; it typically occurs N-terminal to glycosyl hydrolase domains in chitinases, together with other carbohydrate-binding domains, or by itself in tandem-repeat arrangements.
395135	Chitin_bind_1	1.13e-06	107	141	1	32	Chitin recognition protein.
395135	Chitin_bind_1	9.42e-06	44	66	14	36	Chitin recognition protein.
211311	ChtBD1	5.36e-05	44	67	14	37	Hevein or type 1 chitin binding domain. Hevein or type 1 chitin binding domain (ChtBD1), a lectin domain found in proteins from plants and fungi that bind N-acetylglucosamine, plant endochitinases, wound-induced proteins such as hevein, a major IgE-binding allergen in natural rubber latex, and the alpha subunit of Kluyveromyces lactis killer toxin. This domain is involved in the recognition and/or binding of chitin subunits; it typically occurs N-terminal to glycosyl hydrolase domains in chitinases, together with other carbohydrate-binding domains, or by itself in tandem-repeat arrangements.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRC94890.1|CBM18	7.59e-218	1	421	1	421
QRC93519.1|CBM18	7.84e-48	9	166	9	153
QRC98400.1|CBM18	1.12e-45	4	167	3	167
QBZ63121.1|CBM18	6.97e-31	1	165	1	147
BAI44116.1|CBM18	1.07e-30	1	165	1	147

PDB Hits     

QRC94890.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A1L3THR9|CDA_PESTX	1.50e-08	25	71	254	297	Chitin deacetylase OS=Pestalotiopsis sp. OX=36460 GN=CDA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000235	0.999739	CS pos: 19-20. Pr: 0.9794

TMHMM  Annotations     

There is no transmembrane helices in QRC94890.1.