CAZyme Information: QRC94889.1

Basic Information

• Species: Parastagonospora nodorum
• Lineage: Ascomycota; Dothideomycetes; ; Phaeosphaeriaceae; Parastagonospora; Parastagonospora nodorum
• CAZyme ID: QRC94889.1
• CAZy Family: CBM18
• CAZyme Description: rhamnogalacturonan endolyase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
571		64206.47	8.9973

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PnodorumSN15	17580	321614	132	17448

• Gene Location: location=CP069027:581139-583002(+)

Full Sequence      

MGVIKFFACSLAVLAAASPVEQRNKKAPKSFFKELGNSTWVIGNDVWNVTQNRQYADQLW
YKGKDRVGKAVGHYVSYNGAASDLNWTSAAIADSGSDWINVRFTAKEGDFHWLIRDGLAG
AHQYFINRALPTLGEFRTLWRLDNASFPRGYNNVKDGDLPALAEYANATNVQDETWQKAD
GTFLTKYDWSGNLREQRVWGVYGREVGSWYVHAGKEYFNGDQTKQELMVHRESKTGDAVQ
LNMIHGTHFQATSRDSFAPGKLWGPWLWYLNDGSVADAHRQFDQEVRSWPYKWFAETDAS
FRSRGKIQGRLRLSDGRPASGATVFLGDNRNSTISTLDQGKGYYYTTYADEQGKFSIRDI
RTGTYALYAWANGGAISDVTTNLTHNDVVVSEGQNTNLKDLTWAVRDQRKRVFQLGAFDR
KTDGFGLANLQKPFEHARISKCPANLTYTVGTSKEADWCFGQSTVGTWKIKFPIRSECSD
AKLTLSLAGFSQGSSADVLLNGNKVGNITSASLVNSQDTYRGATRSGEWRLLEFPVKEGG
LRQGWNELDVRVTNATQWRGWLWDSVVLEWV

Enzyme Prediction     

No EC number prediction in QRC94889.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL4	41	555	5.6e-244	0.9922928709055877

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
199907	RGL4_N	1.20e-62	41	278	20	264	N-terminal catalytic domain of rhamnogalacturonan lyase, a family 4 polysaccharide lyase. The rhamnogalacturonan lyase of the polysaccharide lyase family 4 (RGL4) is involved in the degradation of RG (rhamnogalacturonan) type-I, an important pectic plant cell wall polysaccharide, by cleaving the alpha-1,4 glycoside bond between L-rhamnose and D-galacturonic acids in the backbone of RG type-I through a beta-elimination reaction. RGL4 consists of three domains, an N-terminal catalytic domain, a middle domain with a FNIII type fold and a C-terminal domain with a jelly roll fold; the middle and C-terminal domains are both putative carbohydrate binding modules. There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain (RG chain) through the beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.
405384	CBM-like	7.11e-42	411	568	1	157	Polysaccharide lyase family 4, domain III. CBM-like is domain III of rhamnogalacturonan lyase (RG-lyase). The full-length protein specifically recognizes and cleaves alpha-1,4 glycosidic bonds between l-rhamnose and d-galacturonic acids in the backbone of rhamnogalacturonan-I, a major component of the plant cell wall polysaccharide, pectin. This domain possesses a jelly roll beta-sandwich fold structurally homologous to carbohydrate binding modules (CBMs), and it carries two sulfate ions and a hexa-coordinated calcium ion.
199905	RGL4_C	8.45e-29	413	569	1	161	C-terminal domain of rhamnogalacturonan lyase, a family 4 polysaccharide lyase. The rhamnogalacturonan lyase of the polysaccharide lyase family 4 (RGL4) is involved in the degradation of RG (rhamnogalacturonan) type-I, an important pectic plant cell wall polysaccharide, by cleaving the alpha-1,4 glycoside bond between L-rhamnose and D-galacturonic acids in the backbone of RG type-I through a beta-elimination reaction. RGL4 consists of three domains, an N-terminal catalytic domain, a middle domain with a FNIII type fold and a C-terminal domain with a jelly roll fold. Both the middle and the C-terminal domain are putative carbohydrate binding modules. There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain (RG chain) through the beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.
199904	RGL4_M	1.59e-23	303	401	1	92	Middle domain of rhamnogalacturonan lyase, a family 4 polysaccharide lyase. The rhamnogalacturonan lyase of the polysaccharide lyase family 4 (RGL4) is involved in the degradation of RG (rhamnogalacturonan) type-I, an important pectic plant cell wall polysaccharide, by cleaving the alpha-1,4 glycoside bond between L-rhamnose and D-galacturonic acids in the backbone of RG type-I through a beta-elimination reaction. RGL4 consists of three domains, an N-terminal catalytic domain, a middle domain with a FNIII type fold and a C-terminal domain with a jelly roll fold. Both the middle domain represented by this model and the C-terminal domain are putative carbohydrate binding modules. There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain (RG chain) through the beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.
405387	fn3_3	6.03e-14	319	397	1	74	Polysaccharide lyase family 4, domain II. FnIII-like is domain II of rhamnogalacturonan lyase (RG-lyase). The full-length protein specifically recognizes and cleaves alpha-1,4 glycosidic bonds between l-rhamnose and d-galacturonic acids in the backbone of rhamnogalacturonan-I, a major component of the plant cell wall polysaccharide, pectin. This domain displays an immunoglobulin-like or more specifically Fibronectin-III type fold and shows highest structural similarity to the C-terminal beta-sandwich subdomain of the pro-hormone/propeptide processing enzyme carboxypeptidase gp180 from duck. It serves to assist in producing the deep pocket, with domain III, into which the substrate fits.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRC94889.1|PL4_5	0.0	1	571	1	571
CBY02118.1|PL4_5	0.0	1	569	1	569
CAE6996798.1|PL4_5	0.0	11	569	9	563
AEO65538.1|PL4_5	1.08e-219	4	570	6	574
BCS19874.1|PL4_5	9.47e-213	13	570	12	572

PDB Hits     

QRC94889.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8RJP2|RHIE_DICD3	1.37e-66	109	552	124	561	Rhamnogalacturonate lyase OS=Dickeya dadantii (strain 3937) OX=198628 GN=rhiE PE=1 SV=1
sp|A5ABH4|RGLB_ASPNC	2.32e-23	104	517	116	586	Probable rhamnogalacturonate lyase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rglB PE=3 SV=1
sp|A1D144|RGLB_NEOFI	6.88e-17	104	517	116	581	Probable rhamnogalacturonate lyase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=rglB PE=3 SV=1
sp|B0XPA2|RGLB_ASPFC	2.80e-16	104	489	116	552	Probable rhamnogalacturonate lyase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=rglB PE=3 SV=1
sp|Q4WR79|RGLB_ASPFU	2.80e-16	104	489	116	552	Probable rhamnogalacturonate lyase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=rglB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000281	0.999685	CS pos: 17-18. Pr: 0.9157

TMHMM  Annotations     

There is no transmembrane helices in QRC94889.1.