CAZyme Information: QRC94025.1

Basic Information

• Species: Parastagonospora nodorum
• Lineage: Ascomycota; Dothideomycetes; ; Phaeosphaeriaceae; Parastagonospora; Parastagonospora nodorum
• CAZyme ID: QRC94025.1
• CAZy Family: AA9
• CAZyme Description: SGNH_hydro domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A7U2EZT6]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
575		63839.11	6.4540

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PnodorumSN15	17580	321614	132	17448

• Gene Location: location=CP069026:569661-571625(-)

Full Sequence      

MLNHRPSGHSRMGVHIVLLLLLTVQSLFVTSVPADLHTHCYFHDRGITDKSRRVDEKPLL
RLMPLGASITQGWDIGTVESLQNGYCKPLRQELRHRGYAVNMVGSRAHGDFSDRQHEGWS
GLKIDDVALKMLPVMTSQKPNLVLILLGSNDCFQGRRENNMDYARTMKDRMRTLIERVYS
TSSDVTIILATIPPTTDAGNEPYIQTANAEYKELASELQGRGRKIELVDMYTTWLKPEDY
SDSIHFKPQGYAKLAALFVDGFSRAEKKGWLTAPIDTGIGDSAGCYPSPNGFHGPVRTQL
GSDGGDLRGDGVRYCDIFGRGNDDYLWSPPYWNGHPHVLDTQLDSKFVDVGEWDGDGLCD
ILTVDRATGNVDMWRNTYKKGDASPTFGAPVRVVDRNLCPQTIPPSNQNDPAHYLTSDLP
NFVWYICMSPKGLSLGWLNRPSGLETLPSTNRAQIKIAEGFSCSEHRWADVNGDGLVDFL
AVEAESGNVILWINCGMVPSLTSGMLWEKRLGFWTPGKGKGANVHFPKLSRSGRADMHVV
DEKTAQADTWFNDGECRGARDDGEVKDPGLPKIPA

Enzyme Prediction     

No EC number prediction in QRC94025.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	60	260	4.7e-49	0.9845360824742269

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	7.91e-52	60	262	1	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
404371	Lipase_GDSL_2	1.88e-16	65	253	2	176	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238141	SGNH_hydrolase	3.78e-15	65	260	4	186	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
238879	NnaC_like	1.35e-12	133	255	45	167	NnaC (CMP-NeuNAc synthetase) _like subfamily of SGNH_hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles two of the three components of typical Ser-His-Asp(Glu) triad from other serine hydrolases. E. coli NnaC appears to be involved in polysaccharide synthesis.
239945	SGNH_hydrolase_like_4	7.95e-11	61	260	2	181	Members of the SGNH-hydrolase superfamily, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKX54758.1|CE3	3.85e-45	60	552	21	512
QIW95188.1|CE3	2.43e-42	60	558	43	523
UDD56943.1|CE0	6.66e-38	293	575	581	866
BAU82433.1|CE3	1.01e-37	58	554	97	556
UQI47280.1|CE3	4.88e-37	58	554	55	516

PDB Hits     

QRC94025.1 has no PDB hit.

Swiss-Prot Hits     

QRC94025.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000275	0.999703	CS pos: 31-32. Pr: 0.9609

TMHMM  Annotations     

Start	End
12	34