CAZyme Information: QRC93954.1

Basic Information

• Species: Parastagonospora nodorum
• Lineage: Ascomycota; Dothideomycetes; ; Phaeosphaeriaceae; Parastagonospora; Parastagonospora nodorum
• CAZyme ID: QRC93954.1
• CAZy Family: PL1
• CAZyme Description: CBM1 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A7U2EVU2]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
248		26038.82	6.4210

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PnodorumSN15	17580	321614	132	17448

• Gene Location: location=CP069026:280145-280986(+)

Full Sequence      

MRYAAAALYATLAGIVTAQAGDWQQCGGTNWSGATTCGANAGCVKINDYYSQCQPGAAPA
NPQPVPTTIVTSTAPAQPSATGAPSGGTPAGTGPGTTLQTGYYWIRAVAAPNFHKYMQTS
PLYSTGSALLGDYTTAGQFQIVNDQLVQLVSAPGEATKLLYGVVSETRYINDNSLSVTFS
ETKNTFGKFVWSGDGLQWSAASVTRPNSGAWYVCSGQLYINLGNYLYQTPAGCADQTIHY
YNDSKANN

Enzyme Prediction     

No EC number prediction in QRC93954.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395595	CBM_1	3.04e-08	23	50	2	29	Fungal cellulose binding domain.
197593	fCBD	3.18e-08	23	54	3	34	Fungal-type cellulose-binding domain. Small four-cysteine cellulose-binding domain of fungi

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRC93954.1|CBM1	3.06e-181	1	248	1	248
CAE7024509.1|CBM1	2.03e-108	1	248	1	249
CCD53258.1|CBM1	1.67e-67	12	242	14	241
ATZ47129.1|CBM1	1.67e-67	12	242	14	241
APA06164.1|CBM1	7.11e-62	16	242	20	244

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RV8_A	1.34e-07	18	60	3	45	Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor covalent complex with the aldouronic acid UXXR [Cerrena unicolor],6RV8_B Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor covalent complex with the aldouronic acid UXXR [Cerrena unicolor]
6Q8M_A	4.00e-07	20	53	372	405	GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8M_B GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8N_A GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872],6Q8N_B GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P46239|GUNF_FUSOX	3.63e-10	18	67	17	66	Putative endoglucanase type F OS=Fusarium oxysporum OX=5507 PE=2 SV=1
sp|P0CT87|GCE1_PHACR	4.15e-10	6	58	8	60	4-O-methyl-glucuronoyl methylesterase 1 OS=Phanerochaete chrysosporium (strain RP-78 / ATCC MYA-4764 / FGSC 9002) OX=273507 GN=e_gw1.18.61.1 PE=1 SV=1
sp|B7SIW2|XYNC_PHACH	5.04e-10	4	62	6	64	Endo-1,4-beta-xylanase C OS=Phanerodontia chrysosporium OX=2822231 GN=xynC PE=1 SV=1
sp|Q66NB7|EG5A_PHACH	8.93e-10	1	68	2	67	Manganese dependent endoglucanase Eg5A OS=Phanerodontia chrysosporium OX=2822231 GN=Eg5A PE=1 SV=2
sp|Q7SDR1|GUN3_NEUCR	9.01e-10	8	58	6	56	Endoglucanase gh5-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=gh5-1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000221	0.999752	CS pos: 20-21. Pr: 0.7240

TMHMM  Annotations     

There is no transmembrane helices in QRC93954.1.