CAZyme Information: QRC93387.1

Basic Information

• Species: Parastagonospora nodorum
• Lineage: Ascomycota; Dothideomycetes; ; Phaeosphaeriaceae; Parastagonospora; Parastagonospora nodorum
• CAZyme ID: QRC93387.1
• CAZy Family: AA9
• CAZyme Description: beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
838		90775.86	6.3410

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PnodorumSN15	17580	321614	132	17448

• Gene Location: location=CP069025:602172-604741(-)

Full Sequence      

MGVNIEATLQSLTLEEKIALLAGKDFWETVPIPGKGVPAIKTSDGPNGARGEVFTGGTRA
ACFPAAVCSAATFNPEYAQKIGNALAEETKTKSARVLLAPTMCNHRHPLGGRNFESFSED
PLLAGKMAANVVKGVQERGIAATIKHFAANEQETERLAVDEVVSERALREIYMKPFEISV
KEANPWGVMTAYNKINGTHADSHEFLLKQVLRGEWGWDGLVMSDWGGTNSTADALNAGLD
LEMPGPTRHRSVEAVMAAVKKGEVTEETITERAKNVLKLIEKVGAFEDPSIPPEQSIVNP
AHSKLIRDVAGQGITLLKNDNDILPLKKEDVKGKKIGLFGLAKEALIHGGGSASLNAHYR
ISPEEGLKAAYGNDVEFKFAKGAHTYRLLPPLAHHCTDLEGNSGWTLEQFRSGQTDKPTK
TTHKIKESAFSPVLDVEAKDREVRLTATFVPTESGSHYLGCSGCGPTTVTINGEQVFEQK
HNSPDPMGFLLGGNPEKEFTVSFEAGKSYKVVIHSKPPAGGNPEEWSILAGLPGFRMGFM
NASEHDLDMVTQARDLAKEVDIALVFTGHTPAWETEGQDQLSFNLPRDGSQDKLVEVVSA
ANKKTIVINSTGVAIALPWLPNIAALVQAWFPGQEAGNAIADIISGAVNPSGRLPISWPK
RIEDAPAYGNFPGEKKDGQLTVRYEEGVFVGYRHYDRVAKDKVHFPFGFGLSYTTFSLFG
GHVAQTSSDLFKATVAVKNTGKTAGSTVVQLYVGRKEQSSEHPIKTLAAFKKTTLDPGQE
KSVELEVGLKDFAYFNEAEKKWKVDKGLYDFSFGQSVAHVEIVATVEIEGTKEVLGKL

Enzyme Prediction     

EC	3.2.1.21:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	35	244	3.5e-65	0.9675925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	4.90e-74	63	821	120	758	beta-glucosidase BglX.
224389	BglX	2.22e-69	24	377	47	393	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	2.70e-49	314	692	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	1.11e-46	12	801	60	757	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	3.83e-43	36	279	65	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRC93387.1|GH3	0.0	1	838	1	838
CBX90257.1|GH3	0.0	1	830	1	845
CAE7177448.1|GH3	0.0	1	832	1	832
QGI59406.1|GH3	0.0	2	829	3	830
CCT62926.1|GH3	0.0	2	829	3	830

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	3.53e-182	4	829	5	837	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	2.69e-178	4	829	5	837	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	1.35e-126	1	834	1	674	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
2X40_A	1.91e-117	4	828	3	713	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
5WAB_A	2.26e-116	1	835	1	670	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BFG8|BGLB_EMENI	0.0	4	828	10	836	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|A1CA51|BGLI_ASPCL	3.53e-192	4	836	5	837	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|Q2U8Y5|BGLI_ASPOR	2.04e-191	3	810	4	813	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
sp|B8NDE2|BGLI_ASPFN	4.07e-191	3	809	4	812	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2
sp|Q0CAF5|BGLI_ASPTN	1.01e-188	3	836	4	838	Probable beta-glucosidase I OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.998541	0.001496

TMHMM  Annotations     

There is no transmembrane helices in QRC93387.1.