CAZyme Information: QRC93131.1

Basic Information

• Species: Parastagonospora nodorum
• Lineage: Ascomycota; Dothideomycetes; ; Phaeosphaeriaceae; Parastagonospora; Parastagonospora nodorum
• CAZyme ID: QRC93131.1
• CAZy Family: AA7
• CAZyme Description: Glyco_transf_20 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A7U2EU50]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
920	CP069025|CGC1	103822.70	6.7829

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PnodorumSN15	17580	321614	132	17448

• Gene Location: location=CP069025:104852-107734(+)

Full Sequence      

MTTFVCSLFLPYTADFYNEDTEAKSNPTSPKQEPAPAPVDLSDVGRTSSAGSIRNKSDGP
DSLLKRAPPSHIQLPKPSMAAMLDHEDFFTPGQPSAATHFPRPRDPKSLVRSDAHVSDWG
DSSLYFNQPQLKAEPAPPQTILEYAKAQERKEAQRERPRARQPTKAKVDPRWSKYSVVPA
VQGNGGLSNAVRSAVTLGRISDVYHVGLVGFPTDVLDEDKKKEIYEKFEEEYNALAVYVN
DKDFDGHYAHYCKTILWPVFHYIIPDHPKSKAFLDHSWCFYVKICQAFADRVVQNYKRGD
IIWVHDYHLCLVPQMIRQKLPDAQIGFFLHTAFPSSEVFRCLAARKELLDGMLGANLVAF
QTQEYAHHFLQTCSRILSVEATEDGVQLENRFVNVWSSPIGIDPVALAKARAEPDVKEWI
QTMQKRYEGKRVIVARDKLDNIRGVRQKLLAFELFLNKYPQWRDKVVLIQVATSTAEGDN
ELAATCAEIVTRIDAVHSTLTHNPLVFLRQDIAFSQYMALLSIADALAITSLREGMNLTC
HEFIACQDGKASPKKHGPVILSEFTGSAAMFDGAELGVNPWNYANIAEAFRCALEMTDEE
KLRRFSKMRNLVMHHTGDFWISNLSKHLAKVHEEQFNRDTMSIPRLSVSNLSREYEEGRK
RLFLLDYEGTLASYGSVNSTVLTSTERVIDVVSDLVADSRNIVYVMSGRTVQESELIFNR
VKGLGLIAENGCFIRDPNSEEWTQFPNERKTIKWKEACKSILQYYLERVEGSFLEERHCS
LIFHYDMAHDKDSSSRHAGDCANHINDACEQQRVKAVPTKDSVIIEPLDFDKATAAQHIF
GKFHPTERPDFLFVAGNDRTDEGVFRWAKVLKDDWTISSVQTVTVGNRNSVALSTLTNGS
TGLLSVLSKLSKIKTPNPES

Enzyme Prediction     

EC	2.4.1.15:11

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	162	629	1.9e-152	0.9515789473684211

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340820	GT20_TPS	0.0	176	629	19	463	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.
395781	Glyco_transf_20	0.0	206	629	49	469	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.
184712	PRK14501	3.54e-163	161	892	9	706	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
223457	OtsA	1.40e-162	147	633	4	482	Trehalose-6-phosphate synthase [Carbohydrate transport and metabolism].
215555	PLN03063	2.20e-130	152	856	5	707	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRC93131.1|GT20	0.0	1	920	1	920
CBX97101.1|GT20	0.0	1	914	1	911
CAE7177637.1|GT20	0.0	1	912	1	916
QDS72670.1|GT20	0.0	1	914	1	911
QSZ35222.1|GT20	0.0	1	913	1	925

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JBI_A	1.23e-100	210	631	47	465	Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBI_B Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBR_A Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_B Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_D Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_F Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_H Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_K Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_M Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_O Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBW_A Structure of Tps1/UDP complex [Pyricularia oryzae 70-15],6JBW_B Structure of Tps1/UDP complex [Pyricularia oryzae 70-15]
5HVM_A	8.71e-96	210	620	59	466	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVM_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
5DXF_A	4.05e-95	216	622	114	517	Structure of Candida albicans trehalose-6-phosphate phosphatase N-terminal domain [Candida albicans SC5314],5DXF_B Structure of Candida albicans trehalose-6-phosphate phosphatase N-terminal domain [Candida albicans SC5314]
5HUT_A	2.28e-94	210	639	51	478	Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUT_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUU_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HUU_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HVL_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314],5HVL_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314]
5HUV_A	3.18e-94	210	639	51	478	Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314],5HUV_B Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O14081|TPSX_SCHPO	1.31e-187	175	872	200	900	Putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 106 kDa subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC2E11.16c PE=1 SV=1
sp|Q9UUI7|TPSY_SCHPO	8.13e-177	173	910	161	889	Putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 100 kDa subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC22F8.05 PE=1 SV=1
sp|P38426|TPS3_YEAST	7.07e-152	175	844	314	955	Trehalose synthase complex regulatory subunit TPS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TPS3 PE=1 SV=3
sp|P38427|TSL1_YEAST	1.34e-146	175	849	346	996	Trehalose synthase complex regulatory subunit TSL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TSL1 PE=1 SV=1
sp|Q54K57|TPSA_DICDI	3.04e-119	184	788	43	627	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] A OS=Dictyostelium discoideum OX=44689 GN=tpsA PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999968	0.000085

TMHMM  Annotations     

There is no transmembrane helices in QRC93131.1.