CAZyme Information: QRC92752.1

Basic Information

• Species: Parastagonospora nodorum
• Lineage: Ascomycota; Dothideomycetes; ; Phaeosphaeriaceae; Parastagonospora; Parastagonospora nodorum
• CAZyme ID: QRC92752.1
• CAZy Family: AA7
• CAZyme Description: pectate lyase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
311	CP069024|CGC9	34292.53	4.8864

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PnodorumSN15	17580	321614	132	17448

• Gene Location: location=CP069024:2271180-2272271(-)

Full Sequence      

MKLTRSLALPLLASLCSAAAVRRQQGDGPQGGADSTQGDLGGRPLPRFPFPMLEFPVAKE
TIVLNETMYIQPGQVWDGQMKRYERVEGSCNEQAEGTDADAVFNLLPGSTIRNVIIGKHQ
SEGIHALGDAWVENVWWEDVCEDALTSKGLNTQLRVIGGGARNAQDKIFQDNSLGGKYNI
TGFVADTFGTFYQSCGNCLNQSKRNATIQNVVAINGTRMGIINPNYGDEYRIKDAQIQDV
KFMVDKEIGNNVQTVPYTVGTGPDEKYALYNMTRDHITIFNGTILKQYVPEDPYPWLGEF
WPSLRNGSSNA

Enzyme Prediction     

EC	4.2.2.2:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL3	59	245	1.2e-68	0.9690721649484536

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397360	Pectate_lyase	1.11e-73	55	249	4	195	Pectate lyase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRC92752.1|PL3_2	1.84e-234	1	311	1	311
CBX99900.1|PL3_2	6.20e-190	1	310	1	321
UPK97488.1|PL3_2	1.66e-172	6	302	4	303
QPC59987.1|PL3_2	2.30e-165	6	302	4	302
CZS82099.1|PL3_2	3.26e-165	6	302	4	302

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EE6_A	4.56e-22	63	196	4	135	Crystal Structure Of Pectate Lyase From Bacillus Sp. Strain Ksm-P15. [Bacillus sp. KSM-P15]
4EW9_A	4.34e-20	62	197	8	139	The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725],4EW9_B The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725]
3T9G_A	4.43e-20	62	197	9	140	The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii],3T9G_B The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii]
4Z03_A	3.73e-19	62	197	17	148	C. bescii Family 3 pectate lyase double mutant K108A in complex with trigalacturonic acid [Caldicellulosiruptor bescii DSM 6725],4Z03_B C. bescii Family 3 pectate lyase double mutant K108A in complex with trigalacturonic acid [Caldicellulosiruptor bescii DSM 6725]
4YZ0_A	3.73e-19	62	197	17	148	C. bescii Family 3 pectate lyase double mutant K108A/E39Q in complex with trigalacturonic acid [Caldicellulosiruptor bescii DSM 6725],4YZ0_B C. bescii Family 3 pectate lyase double mutant K108A/E39Q in complex with trigalacturonic acid [Caldicellulosiruptor bescii DSM 6725]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DCY5|PLYD_NEOFI	4.87e-48	52	265	16	230	Probable pectate lyase D OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyD PE=3 SV=1
sp|B0YB89|PLYD_ASPFC	9.96e-48	54	265	19	231	Probable pectate lyase D OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyD PE=3 SV=1
sp|Q4WGV9|PLYD_ASPFU	9.96e-48	54	265	19	231	Probable pectate lyase D OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyD PE=3 SV=1
sp|Q5BA88|PLYD_EMENI	1.31e-47	47	263	37	251	Probable pectate lyase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyD PE=3 SV=1
sp|Q0CJ49|PLYD_ASPTN	3.81e-47	47	268	29	247	Probable pectate lyase D OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=plyD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001957	0.998028	CS pos: 18-19. Pr: 0.8948

TMHMM  Annotations     

There is no transmembrane helices in QRC92752.1.