CAZyme Information: QRC92154.1

Basic Information

• Species: Parastagonospora nodorum
• Lineage: Ascomycota; Dothideomycetes; ; Phaeosphaeriaceae; Parastagonospora; Parastagonospora nodorum
• CAZyme ID: QRC92154.1
• CAZy Family: AA7
• CAZyme Description: Glyco_hydro_cc domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A7U2ESG3]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
334	CP069024|CGC15	36811.78	4.4730

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PnodorumSN15	17580	321614	132	17448

• Gene Location: location=CP069024:1023854-1024858(-)

Full Sequence      

MLYTEPRSRSQRRIAHAALYLSLLASTSTAQESKRGFAFIGDTHTTDNRLLSSNSPLSWY
YNWSPYPNTNLIPSDSLEFVPMIHGIDATQTPQTENVIRGLPESSTHLLSFNEPDGTTGS
GGSSIKPEDAAKAYIDYVVPFRSGDKGGRKWKISHPSTTGSPNGLEWLRSFNESCYEIDK
ENGCPADFVSAHWYGAFDGLAAWLGTLNEFYNVNSSRSENVSIWVTEMGLPQQSAENTVG
MMNQTLPYLDQLEYVEKYAWFGAFRTEDANEWTGDGVALFDEDGGLTELGALYMGDGYKE
GQKGEGEDNAAMGSKRSTRLMVALSLCAVVFGIM

Enzyme Prediction     

No EC number prediction in QRC92154.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH128	53	293	3.4e-53	0.9732142857142857

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
371727	Glyco_hydro_cc	3.96e-76	42	293	3	235	Glycosyl hydrolase catalytic core. This family is probably a glycosyl hydrolase, and is conserved in fungi and some Proteobacteria. The pombe member is annotated as being from IPR013781.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRC92154.1|GH128	1.44e-254	1	334	1	334
CCT61160.1|GH128	8.05e-190	2	334	1	333
CAE7030955.1|GH128	1.91e-184	8	333	8	335
CCT72013.1|GH128	1.31e-115	33	326	23	311
QGI84896.1|GH128	5.31e-115	33	326	23	311

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6UB7_A	3.02e-18	22	299	19	287	Chain A, Glyco_hydro_cc domain-containing protein [Cryptococcus neoformans]
6UAW_A	5.86e-14	34	300	27	282	Crystal structure of a GH128 (subgroup II) endo-beta-1,3-glucanase from Pseudomonas viridiflava (PvGH128_II) in complex with laminaritriose [Pseudomonas viridiflava]
6UAV_A	2.08e-13	34	294	5	254	Crystal structure of a GH128 (subgroup II) endo-beta-1,3-glucanase from Pseudomonas viridiflava (PvGH128_II) [Pseudomonas viridiflava]

Swiss-Prot Hits     

QRC92154.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.064966	0.935012	CS pos: 30-31. Pr: 0.8965

TMHMM  Annotations     

There is no transmembrane helices in QRC92154.1.