CAZyme Information: QRC91692.1

Basic Information

• Species: Parastagonospora nodorum
• Lineage: Ascomycota; Dothideomycetes; ; Phaeosphaeriaceae; Parastagonospora; Parastagonospora nodorum
• CAZyme ID: QRC91692.1
• CAZy Family: AA7
• CAZyme Description: Glyco_trans_2-like domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A7U2HXG7]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
443	CP069024|CGC10	50885.82	7.8337

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PnodorumSN15	17580	321614	132	17448

• Gene Location: location=CP069024:152340-153930(+)

Full Sequence      

MHLIYVVLRRFGHEQRSGYIIIDDTIHVTWSSLLLTCRLLLLYIVVIVTLSNVIDHAVLL
GPTNPSTVIPFLAYCFPLRPFQLSKQPVKRSFNRLLICLVTRGDQVEVVKRSITAIQDMY
QKLDKRISLHVLTEAANAHNFDGMFKKHVSVHAVPSDYRPVKAKYKARNLEWFRINMHLD
ENDWVLHLDEETLVDEYCINTCLDFITKQSCDMGQGVIHFNCNDYWSSVFTGVGDVHRIQ
GDYGDVQWRLRWLNRAAVGIRGSFLLIRGSVENACTWDNDSLTEDYAFCLKAMKMGYTFG
FVPAIARELSPANIGDFVRQRRRWYTGIRRLGDLWGYFTLLRTAALAVQPLYYLASWSFI
KSSTVLQPQWLYNLNMFGLSIGFGTTAWFTALQDWDAGASLAEMLTHQIQGIVYQPLVCI
ADGYALLTSMVSPDEWFYVITKN

Enzyme Prediction     

No EC number prediction in QRC91692.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	184	370	4.4e-29	0.9187817258883249

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404513	Glyco_trans_2_3	9.83e-25	184	360	1	182	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
224136	BcsA	7.67e-15	66	440	23	400	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133043	CESA_CelA_like	1.58e-06	97	327	5	229	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
133057	CESA_NdvC_like	5.38e-05	262	335	160	236	NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. Bradyrhizobium japonicum synthesizes periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans during growth under hypoosmotic conditions. Two genes (ndvB, ndvC) are involved in the beta-(1, 3), beta-(1,6)-glucan synthesis. The ndvC mutant strain resulted in synthesis of altered cyclic beta-glucans composed almost entirely of beta-(1, 3)-glycosyl linkages. The periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans function for osmoregulation. The ndvC mutation also affects the ability of the bacteria to establish a successful symbiotic interaction with host plant. Thus, the beta-glucans may function as suppressors of a host defense response.
404520	Glyco_tranf_2_3	6.61e-05	183	327	89	230	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRC91692.1|GT2	0.0	1	443	1	443
CAE7032892.1|GT2	4.60e-268	4	443	28	446
BCS25143.1|GT2	1.08e-68	75	442	87	451
BCS04949.1|GT2	2.08e-61	92	443	94	445
BCS16511.1|GT2	5.38e-55	127	443	112	428

PDB Hits     

QRC91692.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O01346|EGH_DROME	4.06e-25	95	328	95	330	Beta-1,4-mannosyltransferase egh OS=Drosophila melanogaster OX=7227 GN=egh PE=2 SV=1
sp|A8XAC4|BRE3_CAEBR	6.99e-23	82	328	84	330	Beta-1,4-mannosyltransferase bre-3 OS=Caenorhabditis briggsae OX=6238 GN=bre-3 PE=3 SV=1
sp|Q03562|BRE3_CAEEL	7.76e-22	82	328	84	330	Beta-1,4-mannosyltransferase bre-3 OS=Caenorhabditis elegans OX=6239 GN=bre-3 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999845	0.000175

TMHMM  Annotations     

Start	End
39	61
335	357
370	392