CAZyme Information: QRC91380.1

Basic Information

• Species: Parastagonospora nodorum
• Lineage: Ascomycota; Dothideomycetes; ; Phaeosphaeriaceae; Parastagonospora; Parastagonospora nodorum
• CAZyme ID: QRC91380.1
• CAZy Family: AA5
• CAZyme Description: CAP10 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A7U2HTM4]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
490	CP069023|CGC9	56906.95	7.5380

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PnodorumSN15	17580	321614	132	17448

• Gene Location: location=CP069023:2978636-2980302(+)

Full Sequence      

MLMKKMWVVEERKDKTVYRRRCPGASDILTFFFVSTCALLFLLICSILYGTRTENPHLPG
MVQGVLPAGRCLCQFSSNFQCDTCLDCASNQALLAENATDADPWTFTYKRDRNNYGLDEE
QCQSAFPGQYEDIERAVKLRDRWGKVTEEDLSSFDLTKGMVRGMIYDRELYILETYLVDN
VNRQKAIASLSAMYRSVRSAPATTEIPNIEFVFSVEDLPAQPTKPMWSLARRVQDHHLWL
IPDFGFWSWDMPSLGTLDEVAIEAVERESVEPWDQKQEKLVWRGKITFAPKLRRALLDAA
KGKPWSDVGQLKWTDPNFKEQFLGPVDQCNYMFIAHAEGRSYSGSLKYRQLCRSVIVSHK
LQWIQHYHYLFRNNGSNQNFVEVERDFSDLVPAMEDLLDHPEKAKRIADNSVAVFRERYL
TQAAESCYWRHLIKRWKDVLGFEPMLYKAGGSESSKDGKRVKKDQKRGVRYETFILYEPK
VQYEWPKSAG

Enzyme Prediction     

No EC number prediction in QRC91380.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	206	440	1.7e-17	0.984

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	7.42e-16	205	443	1	256	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	4.32e-15	206	444	79	327	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRC91380.1|GT0	0.0	1	490	1	490
CAE7205608.1|GT0	5.89e-291	1	489	1	486
QMW31614.1|GT0	1.79e-131	41	490	28	463
UDD60541.1|GT0	1.79e-131	41	490	28	463
QRD90629.1|GT0	5.80e-130	41	490	139	574

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5F84_A	5.70e-07	87	443	14	382	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8T045|RUMI_DROME	2.99e-06	87	443	26	394	O-glucosyltransferase rumi OS=Drosophila melanogaster OX=7227 GN=rumi PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000014	0.000010

TMHMM  Annotations     

Start	End
28	50