CAZyme Information: QRC91376.1

Basic Information

• Species: Parastagonospora nodorum
• Lineage: Ascomycota; Dothideomycetes; ; Phaeosphaeriaceae; Parastagonospora; Parastagonospora nodorum
• CAZyme ID: QRC91376.1
• CAZy Family: AA4
• CAZyme Description: Glycoside hydrolase family 105 protein [Source:UniProtKB/TrEMBL;Acc:A0A7U2EQV3]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
380		43401.48	5.4106

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PnodorumSN15	17580	321614	132	17448

• Gene Location: location=CP069023:2965059-2966201(-)

Full Sequence      

MSSLTINALKKQDITSAIELLSYNLVNINDTTGEFLLKLDDGRIIDTKGWDGWEWTHGIG
LYGLWHYYTLTGSTSTLSTIQDWFTRQLALGTTKNINTMSPFLTLAYLYEETGNKTFIPW
LDTWAEWLMHDLPRTKYQGFQHETYNSFNKDELWDDTLMMSALPLAKIGLVLNRPHYVEE
AKRQFLLHCQYLCDTTTGLFFHGWKWNDADSGKLEIGHNFARARWARGNSWLTIAIPDFI
ELLGLEEKDPLRQFLIHTLESQCAALLKLQAENGMWRTLLDVGVEEGSYEEASATAGFAY
GMLKAVRKRYISGEVYQEAAVKAVKAVLQRIDKDGELQEVSFGTGMGHDLQHYKDIKITS
MPYGQAMAIMALGEYLRAFI

Enzyme Prediction     

No EC number prediction in QRC91376.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	49	377	1.5e-107	0.9728915662650602

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226678	YesR	3.36e-104	21	379	4	357	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
400034	Glyco_hydro_88	2.40e-97	27	379	1	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRC91376.1|GH105	7.88e-289	1	380	1	380
CAE7205631.1|GH105	1.06e-240	1	380	1	378
CBX94546.1|GH105	3.53e-239	1	380	1	378
QDS76750.1|GH105	4.47e-189	6	380	8	379
UPK91701.1|GH105	7.70e-186	12	380	11	372

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XUV_A	1.51e-165	13	380	7	373	Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
3QWT_A	2.16e-150	11	379	23	380	Chain A, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	7.96e-146	11	379	24	381	Chain A, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
3K11_A	7.39e-14	177	377	225	412	Crystal structure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
4CE7_A	1.08e-09	154	337	154	333	Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O31521|URHG1_BACSU	1.14e-41	53	377	29	337	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
sp|P9WF04|UH105_ALTSL	1.06e-13	154	376	201	409	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
sp|P0A3U6|PIC1_AGRFC	1.05e-12	169	348	10	186	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
sp|P0A3U7|PIC1_RHIRD	1.05e-12	169	348	10	186	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
sp|L7P9J4|UH105_NONUL	5.68e-09	154	337	161	340	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000046	0.000000

TMHMM  Annotations     

There is no transmembrane helices in QRC91376.1.