CAZyme Information: QRC91127.1

Basic Information

• Species: Parastagonospora nodorum
• Lineage: Ascomycota; Dothideomycetes; ; Phaeosphaeriaceae; Parastagonospora; Parastagonospora nodorum
• CAZyme ID: QRC91127.1
• CAZy Family: AA3
• CAZyme Description: Lytic polysaccharide monooxygenase [Source:UniProtKB/TrEMBL;Acc:A0A7U2EQW1]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
407		40517.27	7.9647

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PnodorumSN15	17580	321614	132	17448

• Gene Location: location=CP069023:2428523-2429746(+)

Full Sequence      

MSIKTTILAVTALLSAANAHIKITQPVPFSKDTLDTSPVTKQNYPCKNDNGFKISTMNQM
AVGTKQTLAFSGTAVHGGGSCQLSVTTDPEPNENSVFKVIKSIEGGCPGVDGATKEYDFE
LPASIPNGKATFAWTWSSKMSGAPELYMNCAPIEVTGGASDKTEFMTLPDMLKYNVGEGC
TSAQNFATKFPNPGSVVEKGAADDQKPPTGSCGSTGSTPAEPSPPAGQPSPPAGQPSPPA
GQPSSPAGQPSASAPPSQPTPPAGGQSSAAAPPSAPSPPPSNPGGVFAPGASAAPTPATS
TTLVTVTGAPTPAKPTVPVGTGTPAQPTPPSTGGGSAPGGSAPAAPGGSASTCSTNGAVV
CNGEKQFGLCNNGNVVWQEVASGTACVNGVISKRSMRVARPRYNRKV

Enzyme Prediction     

No EC number prediction in QRC91127.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA11	20	201	8.5e-63	0.9738219895287958

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
236090	PRK07764	5.56e-10	216	332	390	502	DNA polymerase III subunits gamma and tau; Validated
223021	PHA03247	1.59e-08	208	364	2722	2861	large tegument protein UL36; Provisional
236090	PRK07764	3.11e-08	207	332	590	715	DNA polymerase III subunits gamma and tau; Validated
223039	PHA03307	5.71e-08	191	330	71	207	transcriptional regulator ICP4; Provisional
237865	PRK14951	5.84e-08	206	331	365	491	DNA polymerase III subunits gamma and tau; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRC91127.1|AA11	3.02e-238	1	407	1	407
CBX94475.1|AA11	2.79e-121	1	407	1	324
CAE7207279.1|AA11	9.54e-113	1	402	1	406
CAE7009967.1|AA11	1.15e-54	16	394	18	387
USW51749.1|AA11	5.17e-54	9	222	12	243

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MAH_A	6.10e-47	20	198	1	200	Structure of Aspergillus oryzae AA11 Lytic Polysaccharide Monooxygenase with Zn [Aspergillus oryzae],4MAI_A Structure of Aspergillus oryzae AA11 Lytic Polysaccharide Monooxygenase with Cu(I) [Aspergillus oryzae]

Swiss-Prot Hits     

QRC91127.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000358	0.999619	CS pos: 19-20. Pr: 0.9691

TMHMM  Annotations     

There is no transmembrane helices in QRC91127.1.