CAZyme Information: QRC90931.1

Basic Information

• Species: Parastagonospora nodorum
• Lineage: Ascomycota; Dothideomycetes; ; Phaeosphaeriaceae; Parastagonospora; Parastagonospora nodorum
• CAZyme ID: QRC90931.1
• CAZy Family: AA3
• CAZyme Description: alpha-1,2-Mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1040		114935.95	6.1250

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PnodorumSN15	17580	321614	132	17448

• Gene Location: location=CP069023:2054890-2058064(+)

Full Sequence      

MRQTARPLRRNAPMPGGLPFHLLWTALLWICCWVTAAHGMTDEVIAGLRQETRDIFYHGY
DNYMEHAFPEDELRPLTCGPLTRDRQNPAHIEVNDVLGNYSLTLIDSLSTLAILASSPSP
DDQGRNKPLEDFQDGIKLLVENYGDGTPGPSGQGARARGFDLDSKVQVFETVIRGVGGLL
SAHQFAIGDLPIRGYAAKEEKRKTSHGIFWPNGLVYDGQLLRLANDLADRLLPAFHTPTG
LPYPRVNLRHGVPFYANSPLNMDAKDGQCGTNPRQRGTEITETCSAGAASLVLEFSTLSR
LTGNPRYERAAKDAFWAVWDRRSSIGLIGGGIDAETGQWVSPYTGIGAGIDSFFEYALKT
HILLSGLPYDPANARTESPDAFLAAWEDAHDGIKRQIYRGAQQQHPHYAQVDLYTGAIRA
FWIDSLSAFYQGLLAMAGKLDEAIETHLLYTALWTRYSALPERWSTVTGNIEHGLRWWGG
RPEWIESTWYLYHATKDPWYLHTGEMALRDIKRRCWTKCGWAGLQDVRSGELSDRMESFF
LGETAKYLFLLFDPSHPLNTWDAPFVFTTEGHPLIVPKRLRPRRAPRAEPPLAERQPAPG
VCPLPPAHLPFSISATAARSDIFHAASLARLHLMPVTDSLGTPIIEYSAGHPSVSHSNIH
SPSNFTYYPWTLPLEYIPRNATSSAQAYRTTFDLSFPNMPNSLQAGGMQRVHEGILVSSM
SGLRLGMVREEDMSGSASKDTKLPEHFRIYAISNTALGRDEKVFMSRATMEDFNPLDPFF
TRTRDTNAVDLILDVSPETADAASSSDLSNESNVLASLDSVSDLFLDDSIVEVDPDLLGS
SPSYLSNLLASIQSLLSADAPSHTSTKPPPPPRSTPQRYAIEAALPLGPGAEPLPDTTDP
ELVYSDANPLPWHSIYVHNGQLCEEKLDADIPKKYQVIAIPRGGCSFSDKLRNIPAIPPK
SNSLQVVIIVSSDAEGFVQPLLDDVQHSPSGLLRPHPIPLIMVNGGDEAMEFLKRAKSVG
VRRRYHFLSQGIKIGNLIVL

Enzyme Prediction     

No EC number prediction in QRC90931.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	56	575	7.1e-144	0.9932735426008968

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	1.58e-137	56	576	2	453	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	5.01e-61	49	578	73	520	glycoside hydrolase family 47 protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRC90931.1|GH47	0.0	1	1040	1	1040
CBX91276.1|GH47	0.0	1	1040	3	1057
CAE7031766.1|GH47	0.0	48	1040	6	1007
QDS72860.1|GH47	0.0	20	1040	15	1055
AUW31064.1|GH47	0.0	49	1024	33	1037

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4AYO_A	2.15e-35	41	552	6	413	Structure of The GH47 processing alpha-1,2-mannosidase from Caulobacter strain K31 [Caulobacter sp. K31],4AYP_A Structure of The GH47 processing alpha-1,2-mannosidase from Caulobacter strain K31 in complex with thiomannobioside [Caulobacter sp. K31],4AYQ_A Structure of The GH47 processing alpha-1,2-mannosidase from Caulobacter strain K31 in complex with mannoimidazole [Caulobacter sp. K31],4AYR_A Structure of The GH47 processing alpha-1,2-mannosidase from Caulobacter strain K31 in complex with noeuromycin [Caulobacter sp. K31],5MEH_A Crystal structure of alpha-1,2-mannosidase from Caulobacter K31 strain in complex with 1-deoxymannojirimycin [Caulobacter sp. K31],5NE5_A Crystal structure of family 47 alpha-1,2-mannosidase from Caulobacter K31 strain in complex with kifunensine [Caulobacter sp. K31]
5KIJ_A	5.69e-31	54	576	11	451	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase and Man9GlcNAc2-PA complex [Homo sapiens]
1FMI_A	6.21e-31	54	576	16	456	Crystal Structure Of Human Class I Alpha1,2-Mannosidase [Homo sapiens]
1FO2_A	6.40e-31	54	576	16	456	Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With 1-Deoxymannojirimycin [Homo sapiens],1FO3_A Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With Kifunensine [Homo sapiens]
1X9D_A	1.67e-30	54	576	94	534	Crystal Structure Of Human Class I alpha-1,2-Mannosidase In Complex With Thio-Disaccharide Substrate Analogue [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O94726|MNL1_SCHPO	2.72e-124	48	581	35	482	ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mnl1 PE=3 SV=2
sp|Q925U4|EDEM1_MOUSE	4.04e-114	43	581	120	586	ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Mus musculus OX=10090 GN=Edem1 PE=1 SV=1
sp|Q92611|EDEM1_HUMAN	9.34e-113	43	581	125	591	ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Homo sapiens OX=9606 GN=EDEM1 PE=1 SV=1
sp|P38888|MNL1_YEAST	1.33e-104	37	581	24	507	ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNL1 PE=1 SV=1
sp|Q9SXC9|MNS5_ARATH	4.80e-92	48	576	37	478	Alpha-mannosidase I MNS5 OS=Arabidopsis thaliana OX=3702 GN=MNS5 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.003401	0.996578	CS pos: 39-40. Pr: 0.9009

TMHMM  Annotations     

Start	End
20	37