CAZyme Information: QRC90597.1

Basic Information

• Species: Parastagonospora nodorum
• Lineage: Ascomycota; Dothideomycetes; ; Phaeosphaeriaceae; Parastagonospora; Parastagonospora nodorum
• CAZyme ID: QRC90597.1
• CAZy Family: AA2
• CAZyme Description: Glyco_hydro_cc domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A7U2HWF0]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
300		33340.58	6.8221

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PnodorumSN15	17580	321614	132	17448

• Gene Location: location=CP069023:1318195-1319261(+)

Full Sequence      

MQFLLLTLCLALLAAARTITGEIRTAAAAPKEDPPSRRRGVAYNNPPFANYFDVMNSGGQ
VSWSYNWASRPTEQHTSFEFIPMLWSNQDSSTSKWWDSIKDAGGIFKDNPTHLLAFNEPD
NCRMGSGGACMSVSDSVAAWRQHMEPAKTLKEKMYLGSPAVTNGGTGMGLDWLGQFVKEC
AGCNIDFICIHWYDKANNVQYFKDHINRARDVAGGRPIWITELGPQGTDAEIKSFLDQVI
PWMEDSGDIHRYAYFMAREGLLVNNQGTGLSDIGSHFTYWRRANGGFTTKSNSTIVAAKL

Enzyme Prediction     

No EC number prediction in QRC90597.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH128	55	275	1.4e-60	0.9732142857142857

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
371727	Glyco_hydro_cc	3.18e-78	42	277	1	235	Glycosyl hydrolase catalytic core. This family is probably a glycosyl hydrolase, and is conserved in fungi and some Proteobacteria. The pombe member is annotated as being from IPR013781.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRC90597.1|GH128	8.40e-230	1	300	1	300
CBX99407.1|GH128	1.87e-86	18	277	31	291
CAE7208436.1|GH128	8.85e-80	25	279	41	301
QDS69752.1|GH128	3.86e-60	38	277	155	387
VDB93860.1|GH128	1.38e-54	36	277	197	422

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6UAY_A	8.33e-42	33	277	30	258	Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) [Blastomyces gilchristii],6UAY_B Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) [Blastomyces gilchristii],6UAZ_A Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with glucose [Blastomyces gilchristii],6UAZ_B Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with glucose [Blastomyces gilchristii],6UB1_A Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -3 and -2 subsites [Blastomyces gilchristii],6UB1_B Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -3 and -2 subsites [Blastomyces gilchristii],6UB1_C Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -3 and -2 subsites [Blastomyces gilchristii],6UB1_D Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -3 and -2 subsites [Blastomyces gilchristii]
6UB0_A	1.42e-41	36	277	2	227	Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -2 and -1 subsites [Blastomyces gilchristii SLH14081]
6UAX_A	1.36e-17	34	258	91	319	Crystal structure of a GH128 (subgroup II) endo-beta-1,3-glucanase from Sorangium cellulosum (ScGH128_II) [Sorangium cellulosum So ce56],6UAX_B Crystal structure of a GH128 (subgroup II) endo-beta-1,3-glucanase from Sorangium cellulosum (ScGH128_II) [Sorangium cellulosum So ce56]

Swiss-Prot Hits     

QRC90597.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000320	0.999653	CS pos: 16-17. Pr: 0.9390

TMHMM  Annotations     

There is no transmembrane helices in QRC90597.1.