CAZyme Information: QRC90540.1

Basic Information

• Species: Parastagonospora nodorum
• Lineage: Ascomycota; Dothideomycetes; ; Phaeosphaeriaceae; Parastagonospora; Parastagonospora nodorum
• CAZyme ID: QRC90540.1
• CAZy Family: AA2
• CAZyme Description: GMC_OxRdtase_N domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A7U2HSV3]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
603	CP069023|CGC6	66835.15	5.7837

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PnodorumSN15	17580	321614	132	17448

• Gene Location: location=CP069023:1158061-1159986(+)

Full Sequence      

MSLERVDSVDPAEIYDYIICGGGTSGCVIAGRLAEDLNAKILVLEAGPDNADLENVHMAG
GWSKNFDSETDWNIVTEPMEKVDSRRVNCSRGRFLGGSSGVNGTLCIRGTKQDYDDWGLD
EWNGEKMWAYMKKSETFHSKEWHKQDESVHGTSGPLHTEPHDLAPISERVRESLVDAGLP
YHPDMFSTGETPHGCGDVPRTVHQGLRSTAADFITKGYHRENITIKTSVMVDKILFSKDN
SSEPTATGVSTISKSGAKIDYQARKEVILTAGAYCSPPVLIRSGIGPKEQLEKLDIPVLV
NSPGVGANLQDHVLCFIFYEVSEPNLTNDYLAYHDNAIASSYELWKEKKTGVLSTFPFGI
FGYARLDERLKDSELWQNAKREAGRDPMGLTKDQPNIEFWNTELYGGPKQYDDFPVDYKH
AFAMCTLLFNQHSRGSVTLKTTDPLQNPIVDHAYMQDPLDMLVMSEACRFANEIIMRGSG
TKDIIKGSWPADLAHHEFTSREDWEPHVRKHATTCYHASGTCKMGKEGDKMAVLDSRLRV
KGVRGLRVADVSSIPRVNNGHTQMVAYAIGEGAAEMIREDAKSGGTRGSGGNEFLKLTPE
MRV

Enzyme Prediction     

No EC number prediction in QRC90540.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	15	580	4.6e-162	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	3.73e-104	15	578	6	532	choline dehydrogenase; Validated
225186	BetA	7.85e-97	8	582	1	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
274888	Rv0697	3.92e-69	16	578	2	487	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
398739	GMC_oxred_C	4.25e-35	432	571	2	141	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	1.96e-30	82	312	14	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRC90540.1|AA3_2	0.0	1	603	1	603
UDD65288.1|AA3_2	1.16e-282	13	579	7	572
QMW48130.1|AA3_2	9.47e-282	13	579	7	572
QMW36070.1|AA3_2	9.47e-282	13	579	7	572
AFB81353.1|AA3_2	8.33e-279	10	580	6	575

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3Q9T_A	6.56e-73	15	582	7	574	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	9.15e-73	15	582	7	574	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5ZU2_A	1.28e-72	15	582	7	574	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
3LJP_A	3.89e-66	1	586	1	534	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
2JBV_A	5.42e-66	1	586	1	534	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B2JS89|BETA_PARP8	3.78e-75	12	578	3	533	Oxygen-dependent choline dehydrogenase OS=Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815) OX=391038 GN=betA PE=3 SV=1
sp|Q66D54|BETA_YERPS	1.79e-74	15	578	3	532	Oxygen-dependent choline dehydrogenase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) OX=273123 GN=betA PE=3 SV=1
sp|B2K8U4|BETA_YERPB	1.79e-74	15	578	3	532	Oxygen-dependent choline dehydrogenase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) OX=502801 GN=betA PE=3 SV=1
sp|Q13NG7|BETA_PARXL	2.17e-74	12	578	3	533	Oxygen-dependent choline dehydrogenase OS=Paraburkholderia xenovorans (strain LB400) OX=266265 GN=betA PE=3 SV=1
sp|B2TCJ8|BETA_PARPJ	3.03e-74	12	577	3	532	Oxygen-dependent choline dehydrogenase OS=Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN) OX=398527 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000041	0.000004

TMHMM  Annotations     

There is no transmembrane helices in QRC90540.1.