CAZyme Information: QNG17032.1

Basic Information

• Species: [Candida] glabrata
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; [Candida] glabrata
• CAZyme ID: QNG17032.1
• CAZy Family: GT71
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
477		55622.40	7.2640

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CglabrataBG2	5481	N/A	261	5220

• Gene Location: location=CP048242:753827-755260(-)

Full Sequence      

METRGLIHWLRYYYKVFHRNRTLKAVAVLLSFVLFIYYVRNSDITDKLVTFAGEENVKSF
HAVKANIRANWNQEDDGDKFKKDLSASLQVKLDNILGTQNMSLAEMGELPIDAETIEEQK
SIRYAKLLKDHKATENSTMGFLFKSLANEGLKPSACIYSFVTGNSELRKLLRTIESVQKK
FNHKFGYPWVIISPEPLSEKFHADVEKKLEEFTSAIDDVKTEVEFGTVPPEHWGFPDFID
STVASNARIDLFDIPNGDSQLFRLINRYNAGLAAHHTLLKKYDWYMRVSPGIRLNCEMEY
DIMRWMQDNRKIFGFTLSIKEIERSAKKIWGHNLNFTAHNREFYNPIEKSSLRSYIQVGR
DTYNYCSFSTDLQIVNLNFLRSPVYTKYFEYMDKAGGIFYERWSDSIIQSMAYSTMIPAK
MIQHISPMGYQNKETVVCPADDIMWREYKCECDQGSDISFNRDLTCTQRYKDTQGMF

Enzyme Prediction     

No EC number prediction in QNG17032.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT15	156	433	1.3e-89	0.9816849816849816

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396385	Glyco_transf_15	8.59e-148	112	434	1	313	Glycolipid 2-alpha-mannosyltransferase. This is a family of alpha-1,2 mannosyl-transferases involved in N-linked and O-linked glycosylation of proteins. Some of the enzymes in this family have been shown to be involved in O- and N-linked glycan modifications in the Golgi.
227353	KTR1	7.23e-89	129	476	57	392	Mannosyltransferase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNG17032.1|GT15	0.0	1	477	1	477
UCS34126.1|GT15	0.0	1	477	1	477
UCS28897.1|GT15	0.0	1	477	1	477
UCS39356.1|GT15	0.0	1	477	1	477
UCS23666.1|GT15	0.0	1	477	1	477

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1S4N_A	3.03e-84	137	476	11	337	Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p [Saccharomyces cerevisiae],1S4N_B Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p [Saccharomyces cerevisiae],1S4O_A Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p: binary complex with GDP/Mn [Saccharomyces cerevisiae],1S4O_B Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p: binary complex with GDP/Mn [Saccharomyces cerevisiae],1S4P_A Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p: ternary complex with GDP/Mn and methyl-alpha-mannoside acceptor [Saccharomyces cerevisiae],1S4P_B Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p: ternary complex with GDP/Mn and methyl-alpha-mannoside acceptor [Saccharomyces cerevisiae]
7BOO_A	1.56e-41	152	439	66	350	Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOO_B Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOO_C Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOO_D Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOO_E Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOO_F Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOP_A Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163],7BOP_B Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163],7BOP_C Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163],7BOP_D Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163],7BOP_E Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163],7BOP_F Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163]
5A07_A	3.88e-40	152	439	102	388	X-ray structure of the mannosyltransferase Ktr4p from S. cerevisiae in complex with GDP [Saccharomyces cerevisiae S288C],5A07_B X-ray structure of the mannosyltransferase Ktr4p from S. cerevisiae in complex with GDP [Saccharomyces cerevisiae S288C],5A08_A X-ray structure of the mannosyltransferase Ktr4p from S. cerevisiae [Saccharomyces cerevisiae S288C],5A08_B X-ray structure of the mannosyltransferase Ktr4p from S. cerevisiae [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P27809|KRE2_YEAST	2.90e-84	112	476	79	431	Glycolipid 2-alpha-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KRE2 PE=1 SV=1
sp|P54070|KTR6_YEAST	6.64e-80	137	472	100	432	Mannosyltransferase KTR6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KTR6 PE=1 SV=1
sp|P46592|MNT2_CANAL	1.21e-68	147	476	131	451	Glycolipid 2-alpha-mannosyltransferase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNT2 PE=3 SV=4
sp|P38130|KTR3_YEAST	5.88e-63	164	470	96	392	Probable mannosyltransferase KTR3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KTR3 PE=1 SV=1
sp|P27810|KTR1_YEAST	3.82e-60	159	470	74	376	Alpha-1,2 mannosyltransferase KTR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KTR1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999747	0.000296

TMHMM  Annotations     

Start	End
20	39