CAZyme Information: QNG16379.1

Basic Information

• Species: [Candida] glabrata
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; [Candida] glabrata
• CAZyme ID: QNG16379.1
• CAZy Family: GT48
• CAZyme Description: SUN4

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
345		36039.58	5.0806

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CglabrataBG2	5481	N/A	261	5220

• Gene Location: location=CP048241:1020146-1021183(-)

Full Sequence      

MKFNCVLLAASMVAAAPSPKHDHEDRHAIKRDVDVVTVVEYVGADDGNGFDVKTSTKAQP
SSVATSTRKTLQPSSSSSSSSSSNGGSGSFKDGTIPCSQFPNVDNVVAVDWVGLGGWASV
MNFDGSYGQSCSDGLYCSYACKPGYSKTQWPSEQPSDGKAIGGLLCKNGYLYRTNTNADS
LCQQDIQSANAKNTLGKSVALCRTDYPGSENMVVPTVVDAGSSQPMSVIDSDSYYQWQGK
KTSAQYYVNNAGVSKEQGCVWGDAASGNGNYAPLIFGSGKSNGVTYLSITKNPNSNSAAN
FNVKIEGADGADVGGTCVYENGQFSSGSDGCTVAVKSGVANFIFY

Enzyme Prediction     

No EC number prediction in QNG16379.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH132	56	345	3.3e-120	0.966996699669967

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397780	SUN	2.81e-139	92	332	1	244	Beta-glucosidase (SUN family). Members of this family include Nca3, Sun4 and Sim1. This is a family of yeast proteins, involved in a diverse set of functions (DNA replication, aging, mitochondrial biogenesis and cell septation). BGLA from Candida wickerhamii has been characterized as a Beta-glucosidase EC:3.2.1.21.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNG16379.1|GH132	1.01e-246	1	345	1	345
UCS33477.1|GH132	1.67e-245	1	345	1	345
UCS23016.1|GH132	1.67e-245	1	345	1	345
UCS28248.1|GH132	1.67e-245	1	345	1	345
UCS38706.1|GH132	1.67e-245	1	345	1	345

PDB Hits     

QNG16379.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P46955|NCA3_YEAST	2.03e-130	1	345	1	337	Beta-glucosidase-like protein NCA3, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NCA3 PE=3 SV=1
sp|B3LRC2|UTH1_YEAS1	6.81e-125	87	345	103	362	Probable secreted beta-glucosidase UTH1 OS=Saccharomyces cerevisiae (strain RM11-1a) OX=285006 GN=UTH1 PE=3 SV=1
sp|A7A003|UTH1_YEAS7	6.81e-125	87	345	103	362	Probable secreted beta-glucosidase UTH1 OS=Saccharomyces cerevisiae (strain YJM789) OX=307796 GN=UTH1 PE=3 SV=2
sp|B5VMJ0|UTH1_YEAS6	6.81e-125	87	345	103	362	Probable secreted beta-glucosidase UTH1 OS=Saccharomyces cerevisiae (strain AWRI1631) OX=545124 GN=UTH1 PE=3 SV=2
sp|P36135|UTH1_YEAST	7.53e-125	87	345	106	365	Probable secreted beta-glucosidase UTH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UTH1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000272	0.999692	CS pos: 15-16. Pr: 0.9797

TMHMM  Annotations     

There is no transmembrane helices in QNG16379.1.