CAZyme Information: QNG15796.1

Basic Information

• Species: [Candida] glabrata
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; [Candida] glabrata
• CAZyme ID: QNG15796.1
• CAZy Family: GT91
• CAZyme Description: AMPKBI domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A7G7JJT1]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
432	CP048240|CGC5	49166.25	4.9885

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CglabrataBG2	5481	N/A	261	5220

• Gene Location: location=CP048240:928007-929305(-)

Full Sequence      

MGNNPSLDYQRTVKNSPRKHKEMVQVDDIEARVADIDLQNSEQPPAERVLNRKKSTLLFD
DESNNEEEYSEENEEEKVRYRAESISSTSSCSSHASDDIQQDEVCDRTEEATKLERQSRE
DHSDEHIRTATQSESDLARTTTNTTEVGIDESRHEEKEKQESSSSASNGMVPVEIRWEQG
GEKVYVTGSFTNWRKMIGLIPVESEPGNFKIKLQLAPGTHRFRFIVDNQLRFSDNLPTAT
DQMGNFVNYLEVSAVPKSDSTSSRTGKERKDKNKKSVSKVSKDRSTVGPLSARSCIALEI
EKEPDDFGDGYTRYHEELPQEPKYEFSSEIPAIFVDQSIIEQLTMERQRKKSNNMSWLTP
PQLPPQLENVILNKFGEPLSQSTENNAGALPIPNHSVLNHLVTTSIKHNTLCVATNNRYR
QKYVSQIYYVPL

Enzyme Prediction     

No EC number prediction in QNG15796.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
406865	AMPK1_CBM	1.85e-43	171	254	1	81	Glycogen recognition site of AMP-activated protein kinase. AMPK1_CBM is a family found in close association with AMPKBI pfam04739. The surface of AMPK1_CBM reveals a carbohydrate-binding pocket.
214973	AMPKBI	2.22e-39	320	432	1	100	5'-AMP-activated protein kinase beta subunit, interation domain. This region is found in the beta subunit of the 5'-AMP-activated protein kinase complex, and its yeast homologues Sip1, Sip2 and Gal83, which are found in the SNF1 kinase complex. This region is sufficient for interaction of this subunit with the kinase complex, but is not solely responsible for the interaction, and the interaction partner is not known. The isoamylase N-terminal domain is sometimes found in proteins belonging to this family.
398422	AMPKBI	1.09e-29	360	431	3	69	5'-AMP-activated protein kinase beta subunit, interaction domain. This region is found in the beta subunit of the 5'-AMP-activated protein kinase complex, and its yeast homologs Sip1, Sip2 and Gal83, which are found in the SNF1 kinase complex. This region is sufficient for interaction of this subunit with the kinase complex, but is not solely responsible for the interaction, and the interaction partner is not known. The isoamylase N-terminal domain (pfam02922) is sometimes found in proteins belonging to this family.
199889	E_set_AMPKbeta_like_N	2.56e-26	172	252	1	80	N-terminal Early set domain, a glycogen binding domain, associated with the catalytic domain of AMP-activated protein kinase beta subunit. E or "early" set domains are associated with the catalytic domain of AMP-activated protein kinase beta subunit glycogen binding domain at the N-terminal end. AMPK is a metabolic stress sensing protein that senses AMP/ATP and has recently been found to act as a glycogen sensor as well. The protein functions as an alpha-beta-gamma heterotrimer. This N-terminal domain is the glycogen binding domain of the beta subunit. This domain is also a member of the CBM48 (Carbohydrate Binding Module 48) family whose members include pullulanase, maltooligosyl trehalose synthase, starch branching enzyme, glycogen branching enzyme, glycogen debranching enzyme, and isoamylase.
199878	E_set	4.57e-05	172	229	1	59	Early set domain associated with the catalytic domain of sugar utilizing enzymes at either the N or C terminus. The E or "early" set domains of sugar utilizing enzymes are associated with different types of catalytic domains at either the N-terminal or C-terminal end. These domains may be related to the immunoglobulin and/or fibronectin type III superfamilies. Members of this family include alpha amylase, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase. A subset of these members were recently identified as members of the CBM48 (Carbohydrate Binding Module 48) family. Members of the CBM48 family include pullulanase, maltooligosyl trehalose synthase, starch branching enzyme, glycogen branching enzyme, glycogen debranching enzyme, isoamylase, and the beta subunit of AMP-activated protein kinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNG15796.1|CBM48	3.83e-279	1	432	1	432
QHS68289.1|CBM48	2.21e-278	1	432	1	432
CAG61589.1|CBM48	2.21e-278	1	432	1	432
UCS32892.1|CBM48	1.05e-276	1	432	1	432
UCS22431.1|CBM48	1.05e-276	1	432	1	432

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2QLV_B	5.15e-105	170	432	3	252	Crystal structure of the heterotrimer core of the S. cerevisiae AMPK homolog SNF1 [Saccharomyces cerevisiae],2QLV_E Crystal structure of the heterotrimer core of the S. cerevisiae AMPK homolog SNF1 [Saccharomyces cerevisiae]
3T4N_B	7.66e-40	325	432	2	110	Structure of the regulatory fragment of Saccharomyces cerevisiae AMPK in complex with ADP [Saccharomyces cerevisiae S288C],3TDH_B Structure of the regulatory fragment of sccharomyces cerevisiae AMPK in complex with AMP [Saccharomyces cerevisiae S288C],3TE5_B structure of the regulatory fragment of sacchromyces cerevisiae ampk in complex with NADH [Saccharomyces cerevisiae S288C]
4RER_B	1.23e-19	172	432	3	197	Crystal structure of the phosphorylated human alpha1 beta2 gamma1 holo-AMPK complex bound to AMP and cyclodextrin [Homo sapiens]
4REW_B	1.68e-19	172	432	3	197	Crystal structure of the non-phosphorylated human alpha1 beta2 gamma1 holo-AMPK complex [Homo sapiens]
6B2E_B	5.25e-19	172	432	78	272	Structure of full length human AMPK (a2b2g1) in complex with a small molecule activator SC4. [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q04739|GAL83_YEAST	3.60e-106	170	432	161	416	SNF1 protein kinase subunit beta-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GAL83 PE=1 SV=1
sp|P34164|SIP2_YEAST	3.89e-102	167	432	160	412	SNF1 protein kinase subunit beta-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SIP2 PE=1 SV=3
sp|P78789|AAKB_SCHPO	4.50e-29	167	425	95	289	5'-AMP-activated protein kinase subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=amk2 PE=1 SV=2
sp|O43741|AAKB2_HUMAN	3.68e-18	172	432	78	272	5'-AMP-activated protein kinase subunit beta-2 OS=Homo sapiens OX=9606 GN=PRKAB2 PE=1 SV=1
sp|Q6PAM0|AAKB2_MOUSE	4.93e-18	172	432	77	271	5'-AMP-activated protein kinase subunit beta-2 OS=Mus musculus OX=10090 GN=Prkab2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000074	0.000000

TMHMM  Annotations     

There is no transmembrane helices in QNG15796.1.