CAZyme Information: QNG15303.1

Basic Information

• Species: [Candida] glabrata
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; [Candida] glabrata
• CAZyme ID: QNG15303.1
• CAZy Family: GT22
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
427		44111.47	4.7096

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CglabrataBG2	5481	N/A	261	5220

• Gene Location: location=CP048239:1013661-1014944(+)

Full Sequence      

MKFLTTAATLTAASILGSTALAAAMPDLKDCTTTAQGNHQHKRAVAVEYVYETVIVDDQG
HTLNVPPVKNDAASPTQAPKQSTQTPAAAPSTSTLAPASSSSPSPAKKADSTTSTLAPSS
SSSPSPSPSPSSSSSSSSQQSKPSSSTSSSSSYSGGIYGDLAAFSGPSEKFQDGVIPCSQ
FPAGQGVIPISWLGENGWSGVENSDTSTGGDCKEGSYCSYACQPGMSKTQWPSSQPADGR
SIGGLLCKNGYLYRSNTNADYLCEWGVNSAEVESKLSQGVAICRTDYPGTENMVIPTFVQ
AGATLPLTVVNQDTYYQWQGMKTSAQYYVNNAGISVEDGCVWGNAGSGLGNWAPLNFGAG
YTNGITYLSLIPNPNNKAPLNYNVKIVAADDSSVVNGECSYENGVYSGGADGCTVAVRSG
KAKFVLY

Enzyme Prediction     

No EC number prediction in QNG15303.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH132	130	427	4.2e-132	0.9636963696369637

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397780	SUN	9.94e-150	173	414	1	244	Beta-glucosidase (SUN family). Members of this family include Nca3, Sun4 and Sim1. This is a family of yeast proteins, involved in a diverse set of functions (DNA replication, aging, mitochondrial biogenesis and cell septation). BGLA from Candida wickerhamii has been characterized as a Beta-glucosidase EC:3.2.1.21.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNG15303.1|GH132	9.84e-268	1	427	1	427
CAG61092.1|GH132	5.68e-267	1	427	1	427
QHS67794.1|GH132	5.68e-267	1	427	1	427
UCS37629.1|GH132	7.93e-263	1	427	1	429
UCS27171.1|GH132	7.93e-263	1	427	1	429

PDB Hits     

QNG15303.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P53616|SUN4_YEAST	1.65e-180	7	427	5	419	Probable secreted beta-glucosidase SUN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUN4 PE=1 SV=1
sp|P40472|SIM1_YEAST	2.26e-167	157	427	205	475	Probable secreted beta-glucosidase SIM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SIM1 PE=1 SV=2
sp|Q59NP5|SUN41_CANAL	4.41e-138	156	427	146	417	Secreted beta-glucosidase SUN41 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SUN41 PE=1 SV=2
sp|Q5AKU5|UTH1_CANAL	3.59e-123	157	427	103	372	Secreted beta-glucosidase SIM1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SIM1 PE=1 SV=1
sp|B3LRC2|UTH1_YEAS1	3.64e-123	168	427	103	362	Probable secreted beta-glucosidase UTH1 OS=Saccharomyces cerevisiae (strain RM11-1a) OX=285006 GN=UTH1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000224	0.999744	CS pos: 22-23. Pr: 0.9748

TMHMM  Annotations     

There is no transmembrane helices in QNG15303.1.