CAZyme Information: QNG14840.1

Basic Information

• Species: [Candida] glabrata
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; [Candida] glabrata
• CAZyme ID: QNG14840.1
• CAZy Family: GT2
• CAZyme Description: Glucose N-acetyltransferase 1 [Source:UniProtKB/TrEMBL;Acc:A0A0W0E0J5]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
501	CP048238|CGC1	58317.35	9.0880

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CglabrataBG2	5481	N/A	261	5220

• Gene Location: location=CP048238:549062-550567(-)

Full Sequence      

MRLVSRRRLKGLALVAFALIGITIFVRILMEFQLEREVSFYKKFFRLKKDGLHGVYNPID
IKQIPKQTIDDLYRAKMETVSASKPIDWSKYAYVNYVTEPNYLCNTLIMFHALIKKFGTK
AKLELLISNELFKSEIQSRNEQVQRILKKIRELDSEQIVIKEVQNIVKPTDQSPWNESLT
KLLVFGLTEYERIIYLDNDAILQDKMDELFFLPNDITFAAPLTYWFMSEKDLEKTYKEVQ
HDKMSINLNKYTKQLSNRIRNGKEIYNHLPALPQSLYLNSDRVAKEILDSTSSASPLFDA
DSLKKVGKVKFASNLMVIKPSQETYDYIINDCLPRIVNKKEKYDMDLINEELYNLRHVVS
RQVTLFRKLRSAFKPSILVLPFGTYGILTGSIRKPQEHMIMRNDILGYKNIDDEGNEIQK
SIEEVVLNNKYIHFSDFPLGKPWAYSSFDQLKCRVDPATSKDVAADQKNCDVWNSIYESY
FTQRTVCSKDDSPKASEIQAA

Enzyme Prediction     

EC	2.4.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	76	445	6.2e-23	0.9377431906614786

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133064	GT8_GNT1	2.64e-80	91	480	1	278	GNT1 is a fungal enzyme that belongs to the GT 8 family. N-acetylglucosaminyltransferase is a fungal enzyme that catalyzes the addition of N-acetyl-D-glucosamine to mannotetraose side chains by an alpha 1-2 linkage during the synthesis of mannan. The N-acetyl-D-glucosamine moiety in mannan plays a role in the attachment of mannan to asparagine residues in proteins. The mannotetraose and its N-acetyl-D-glucosamine derivative side chains of mannan are the principle immunochemical determinants on the cell surface. N-acetylglucosaminyltransferase is a member of glycosyltransferase family 8, which are, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed, retaining glycosyltransferases.
227884	Gnt1	4.01e-53	1	357	1	300	Alpha-N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
133018	GT8_Glycogenin	1.28e-14	91	225	1	124	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.
132996	Glyco_transf_8	1.67e-05	91	261	1	168	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.
215090	PLN00176	0.002	151	214	69	137	galactinol synthase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNG14840.1|GT8	0.0	1	501	1	501
UCS31937.1|GT8	0.0	1	500	1	500
UCS21476.1|GT8	0.0	1	500	1	500
UCS26707.1|GT8	0.0	1	500	1	500
UCS37165.1|GT8	0.0	1	500	1	500

PDB Hits     

QNG14840.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6FQ15|GNT1_CANGA	0.0	1	501	1	501	Glucose N-acetyltransferase 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=GNT1 PE=3 SV=1
sp|Q12096|GNT1_YEAST	1.26e-199	1	487	1	489	Glucose N-acetyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GNT1 PE=1 SV=1
sp|Q6CT96|GNT1B_KLULA	8.05e-130	6	487	3	450	Glucose N-acetyltransferase 1-B OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=GNT1-B PE=3 SV=1
sp|Q9Y761|GNT1A_KLULA	3.53e-91	5	484	5	454	Glucose N-acetyltransferase 1-A OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=GNT1-A PE=3 SV=1
sp|Q4WBL2|GNT1_ASPFU	4.49e-30	86	489	75	375	Glucose N-acetyltransferase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gnt1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000023	0.000012

TMHMM  Annotations     

Start	End
12	34