CAZyme Information: QNG14108.1

Basic Information

• Species: [Candida] glabrata
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; [Candida] glabrata
• CAZyme ID: QNG14108.1
• CAZy Family: GH72|CBM43
• CAZyme Description: Cellulase domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A7G7JEZ3]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
423	CP048236|CGC6	48675.09	4.3547

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CglabrataBG2	5481	N/A	261	5220

• Gene Location: location=CP048236:920645-921916(-)

Full Sequence      

MLSIICFFITLAFAAPLQKRLFNYDENIIRGVNIGGWLVLEPYITPSLFEQFRTNPYNDD
GIPVDEYHFCQQLGYDAAQQQLINHWSNFYQESDFQDIANKGFNLVRIPVGYWAFKTMQG
DPYVTGVQEQYLDNAIEWASKYGLKVWVDLHGAAGSQNGFDNSGQRDTLNFPNDDYNVQV
TTDVINYLLNKYSQDEYLETVIGVELINEPLGPAIDMNKLKFNYYKPAYDYLRDTVQKPQ
NIIMHDAFQPYNYWDDFLTLDQGAWGVTVDHHHYQVFSGGELQRDINAHVSVACGWGSGV
LNEAHWTVAGEWSAALTDCTKWLNGVGIGARYDGSFWKNGVGSSYIGSCANNEDINSWTE
DRKQNTRRYIEAQLDAFELRGGWIFWCYKTETSIEWDASRLIEYGLFPQPMESRWYPNQC
GFS

Enzyme Prediction     

EC	3.2.1.58:29	3.2.1.21:6	3.2.1.75:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	84	391	6.6e-125	0.9966996699669967

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	6.22e-100	28	421	17	395	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	2.15e-08	86	244	19	164	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNG14108.1|GH5_9	0.0	1	423	1	423
CAG59700.1|GH5_9	0.0	1	423	1	423
QHS66409.1|GH5_9	0.0	1	423	1	423
UCS20741.1|GH5_9	0.0	1	423	1	423
UCS36431.1|GH5_9	0.0	1	423	1	423

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1H4P_A	3.38e-217	22	421	2	404	Crystal structure of exo-1,3-beta glucanse from Saccharomyces cerevisiae [Saccharomyces cerevisiae],1H4P_B Crystal structure of exo-1,3-beta glucanse from Saccharomyces cerevisiae [Saccharomyces cerevisiae]
1EQP_A	3.73e-175	23	422	3	393	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
1CZ1_A	7.51e-175	23	422	3	393	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
2PB1_A	9.29e-175	23	422	9	399	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]
2PBO_A	2.65e-174	23	422	9	399	Chain A, Hypothetical protein XOG1 [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P23776|EXG1_YEAST	3.04e-222	18	421	38	444	Glucan 1,3-beta-glucosidase I/II OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=EXG1 PE=1 SV=1
sp|Q876J3|EXG_SACU7	6.74e-219	18	420	38	443	Glucan 1,3-beta-glucosidase OS=Saccharomyces uvarum (strain ATCC 76518 / CBS 7001 / CLIB 283 / NBRC 10550 / MCYC 623 / NCYC 2669 / NRRL Y-11845) OX=659244 GN=EXG1 PE=3 SV=1
sp|Q875R9|EXG_LACK1	6.56e-217	18	422	37	439	Glucan 1,3-beta-glucosidase OS=Lachancea kluyveri (strain ATCC 58438 / CBS 3082 / BCRC 21498 / NBRC 1685 / JCM 7257 / NCYC 543 / NRRL Y-12651) OX=226302 GN=EXG1 PE=3 SV=1
sp|Q876J2|SPR1_SACU7	1.14e-209	29	420	54	444	Sporulation-specific glucan 1,3-beta-glucosidase OS=Saccharomyces uvarum (strain ATCC 76518 / CBS 7001 / CLIB 283 / NBRC 10550 / MCYC 623 / NCYC 2669 / NRRL Y-11845) OX=659244 GN=SPR1 PE=3 SV=1
sp|P32603|SPR1_YEAST	1.08e-207	29	420	54	444	Sporulation-specific glucan 1,3-beta-glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SPR1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001088	0.998887	CS pos: 14-15. Pr: 0.9499

TMHMM  Annotations     

There is no transmembrane helices in QNG14108.1.