CAZyme Information: QNG13929.1

Basic Information

• Species: [Candida] glabrata
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; [Candida] glabrata
• CAZyme ID: QNG13929.1
• CAZy Family: GH72
• CAZyme Description: TPS2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
890		101835.81	7.1803

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CglabrataBG2	5481	N/A	261	5220

• Gene Location: location=CP048236:521127-523799(+)

Full Sequence      

MTVPATKKQRIINCVSQLPYKIQLGETNDDWKITHVTGNSALYSSLDYLNYDLQGEVEHH
VVGWTGEVTREASVPNFTKEDKDKHDASEEDPMYLTKEQISGLTSTLQDQMKVEDSNSTV
HPVWLLRRDQSRWRSYAEKVIWPTFHYILNPSSANIQQENNWWYDYVKFNEAYANKIAEI
YQKGDIIWIHDYYLLLLPQLLRMRYDQDVAIGYFHHAPWPSHEYFRCLPRRKQILDGLLG
ANKICFQNESFSRHFVSSCKRLLDSSAKKTKNADGFEQYQISAYGGDLIVDSLPIGVNTK
QLLKDAFTKDIDSKVLAIKQAYQNKKIIIGRDRLDPVRGVLQKMRAFETFLEMYPYWRDQ
VVLIQVSSPTANRNSPQTIKLEQQVNELVNSINSKYGSLNFSPVQHYYMRIPKDVYLSLL
RVADLCLITSVRDGMNTTALEYVTLKSNKSSANALSYGNPLVLSEFSGSSTLLKDAILVN
PWDSVAVAKSINMALNMTKDEKSALEDKLWSEVPTIQDWTDKYLKSLKEIIHDSSLGTPS
ADKRITPALNRPILLENYKQAKRRLFLFDYDGTLTPIVQDPAAAIPTARLYSILQKLAAD
PKNQIWIISGRDQKFLNKWLGSKLPQLGLSAEHGCFMKDIGNEDWVNLTEKVDMSWQARV
NDVMEDFTRRTPGSFIERKKVALTWHYRRAVPELGEFHASELQKELLKFTDDSDLEVMEG
KANIEVRPRFVNKGEIVKRLVWHEHGKSQDMLKGINDTLPITEMPDFILCLGDDFTDEDM
FRQLNTIESVWDKKFPDDRNNFGHFGFYPVTVGSASKKTVAKAHLTDPQQVLETLGLLVG
DVSLFQSAGTVELDARGHVKNSESSLKSEQATAQYVLKRTASSQNVKKDK

Enzyme Prediction     

EC	3.1.3.12:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	7	528	5.1e-151	0.9747368421052631

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
184712	PRK14501	0.0	100	839	53	724	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
340820	GT20_TPS	1.94e-176	10	528	1	463	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.
395781	Glyco_transf_20	1.51e-170	60	529	4	470	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.
223457	OtsA	2.30e-155	9	529	15	479	Trehalose-6-phosphate synthase [Carbohydrate transport and metabolism].
215556	PLN03064	1.69e-112	136	781	181	807	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHS66225.1|GT20	0.0	1	890	1	890
CBF70355.1|GT20	0.0	1	890	1	890
CAG59519.1|GT20	0.0	1	890	1	890
QNG13929.1|GT20	0.0	1	890	1	890
CBF98892.1|GT20	0.0	1	890	1	890

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DXF_A	3.42e-163	10	524	32	520	Structure of Candida albicans trehalose-6-phosphate phosphatase N-terminal domain [Candida albicans SC5314],5DXF_B Structure of Candida albicans trehalose-6-phosphate phosphatase N-terminal domain [Candida albicans SC5314]
5DXI_A	7.51e-128	546	843	5	302	Structure of C. albicans Trehalose-6-phosphate phosphatase C-terminal domain [Candida albicans SC5314],5DXI_B Structure of C. albicans Trehalose-6-phosphate phosphatase C-terminal domain [Candida albicans SC5314]
5DXN_A	1.56e-90	546	838	3	269	Structure of Aspergillus fumigatus trehalose-6-phosphate phosphatase crystal form 2 [Aspergillus fumigatus Af293],5DXO_A Structure of Aspergillus fumigatus trehalose-6-phosphate phosphatase crystal form 3 [Aspergillus fumigatus Af293],5DXO_B Structure of Aspergillus fumigatus trehalose-6-phosphate phosphatase crystal form 3 [Aspergillus fumigatus Af293]
5DXL_A	6.69e-87	546	838	3	269	Structure of Aspergillus fumigatus trehalose-6-phosphate phosphatase crystal form 1 [Aspergillus fumigatus Af293]
5HUV_A	5.86e-72	133	536	89	476	Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314],5HUV_B Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9P4D3|TPS2_ZYGRO	0.0	7	885	7	900	Trehalose-phosphatase OS=Zygosaccharomyces rouxii OX=4956 GN=TPS2 PE=1 SV=1
sp|P31688|TPS2_YEAST	0.0	7	882	12	890	Trehalose-phosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TPS2 PE=1 SV=3
sp|P78875|TPP1_SCHPO	7.69e-181	10	835	38	809	Trehalose-phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tpp1 PE=1 SV=2
sp|Q54NU9|TPSB_DICDI	1.48e-142	127	789	133	755	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] B OS=Dictyostelium discoideum OX=44689 GN=tpsB PE=3 SV=1
sp|O14145|TPS2_SCHPO	9.03e-134	9	835	15	846	Trehalose-phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tps2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000057	0.000000

TMHMM  Annotations     

There is no transmembrane helices in QNG13929.1.