CAZyme Information: QNG12696.1

Basic Information

• Species: [Candida] glabrata
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; [Candida] glabrata
• CAZyme ID: QNG12696.1
• CAZy Family: GH132
• CAZyme Description: Trehalase [Source:UniProtKB/TrEMBL;Acc:A0A7G7JAY1]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
750		86431.16	6.9924

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CglabrataBG2	5481	N/A	261	5220

• Gene Location: location=CP048232:406562-408814(+)

Full Sequence      

MPTPTFYLGADDAVDGGVKSKSMAFSDPFHKNVKVQSPEPEPVDAKEKKKLNRTRTMSVF
YNVADFKDDEEIRKHKLKRRASEDDTYISSKGTRRLFVKDVDWTLKELLQNEDTDQNFQI
TVEDTGPKVIKLGTANSAGYNHIDIRGTYMLSNLLQELTIAHNFGQRQLYLPESRLNENP
VHRLKRVIETHFWDGLTRRLDLNTIGEAAQEKKIDTPEAKNPRVYVPYDCPEMYEYFIQA
SQMNPSVKLEVEYLPKDITPEYVQSLNETPGLLAIAMDKHVNPTTGETSLVGFPYVFPGG
RFNELYGWDSYLITLGLLASKRTDLARGMVEHFIFEIEHYGKILNANRTYYLCRSQPPFL
TDMANVTFNGMGGNKNPIAVDLLRRAFRAAIKEYKTVWMAKPRLDEKTGLSCYHPDGVGI
PPETEPEHFDTKLRPYAKKYNVTIPEFRRMYNAKEVHEPELDEFFLHDRGVRESGHDTTY
RLEGVCAYLATIDLNSLLYKYEVDIANFIKEFCNDKYVDPHDKSVTTSEDWMNLANKRKE
RIKYYMWDEEAGFFFDYNVKTEKRTSYESATTFWAMWAGVASPQEAEIMVKKAVPKLETL
GGIVACTESSRGPIAIDRPYRQWDYPFGWAPHQILAWKGFSNYGYDNIARRLVYRWLYMM
TKAFVDYNGIVVEKYDVTKVTDPHKITAEYGNQGVDFKGYAREGFGWVNSSFLLGLQYLD
NHAIRALGACIPPKPFLNGLRAKEKARYGL

Enzyme Prediction     

EC	3.2.1.28:32

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH37	165	718	1.1e-151	0.9918533604887984

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224541	TreA	0.0	87	725	1	558	Neutral trehalase [Carbohydrate transport and metabolism].
395961	Trehalase	0.0	163	719	2	508	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
183934	treF	1.33e-50	253	709	114	536	alpha,alpha-trehalase TreF.
183936	treA	2.82e-47	276	716	130	533	alpha,alpha-trehalase TreA.
215307	PLN02567	6.24e-47	294	709	142	534	alpha,alpha-trehalase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNG12696.1|GH37	0.0	1	750	1	750
UCS24558.1|GH37	0.0	1	750	1	750
UCS19325.1|GH37	0.0	1	750	1	750
UCS35017.1|GH37	0.0	1	750	1	750
UCS29788.1|GH37	0.0	1	750	1	750

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JTA_A	0.0	25	750	25	751	Neutral trehalase Nth1 from Saccharomyces cerevisiae [Saccharomyces cerevisiae]
5M4A_A	0.0	150	750	3	603	Neutral trehalase Nth1 from Saccharomyces cerevisiae in complex with trehalose [Saccharomyces cerevisiae]
5N6N_C	0.0	25	750	30	756	CRYSTAL STRUCTURE OF THE 14-3-3:NEUTRAL TREHALASE NTH1 COMPLEX [Saccharomyces cerevisiae S288C]
5NIS_A	0.0	99	750	5	656	Neutral trehalase Nth1 from Saccharomyces cerevisiae [Saccharomyces cerevisiae S288C]
2JG0_A	4.76e-39	217	720	28	500	Family 37 trehalase from Escherichia coli in complex with 1- thiatrehazolin [Escherichia coli K-12],2JJB_A Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_B Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_C Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_D Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2WYN_A Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_B Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_C Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_D Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q757L1|TREB_ASHGO	0.0	27	750	17	737	Probable trehalase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=NTH2 PE=3 SV=1
sp|P49381|TREA_KLULA	0.0	77	750	81	753	Cytosolic neutral trehalase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=NTH1 PE=1 SV=1
sp|P35172|TREB_YEAST	0.0	25	750	57	780	Probable trehalase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NTH2 PE=1 SV=1
sp|P32356|TREA_YEAST	0.0	25	750	25	751	Cytosolic neutral trehalase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NTH1 PE=1 SV=3
sp|O42777|TREB_EMENI	1.10e-275	21	743	22	740	Cytosolic neutral trehalase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=treB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000033	0.000000

TMHMM  Annotations     

There is no transmembrane helices in QNG12696.1.