CAZyme Information: QHS76674.1

Basic Information

• Species: Saccharomyces paradoxus
• Lineage: Ascomycota; Saccharomycetes; ; Saccharomycetaceae; Saccharomyces; Saccharomyces paradoxus
• CAZyme ID: QHS76674.1
• CAZy Family: GT62
• CAZyme Description: Sur1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
384	CP020257|CGC1	44894.09	9.0472

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SparadoxusCBS432	5803	N/A	275	5528

• Gene Location: location=CP020257:429346-430500(-)

Full Sequence      

MRKELKYLICFNILLLLSIIYYTFDLLTLCIDDTFKDAILEEDLNPPSDAPPKPQLIPKI
IHQTYKTEDIPEHWKEGRQKCLDLHPDYKYILWTDEMAYEFIKEEYPWFLDTFENYKYPI
ERADAIRYFILSHYGGVYIDLDDGCERKLDPLLAFPAFLRKTSPLGVSNDVMGSVPRHPF
FLKALKSLKHYDKYWFIPYMTIMGSTGPLFLSVIWKQYKRWGIPTNGTIRILQPAYYKMH
TYSFFSITKGSSWHLDDAKLMKALENHILSCVVTGFIFGFFILYGEFTFYCWLCSKNFSN
LTKNWKLNSLKVKIVTILNSLGLKLKLSKSTSDAASATLLARQQKRLRKDSNTNIVLLKS
SRKNDVYDLEKNDSSKYTQGNNSS

Enzyme Prediction     

EC	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	73	153	6.5e-23	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	2.36e-116	1	324	10	347	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	2.97e-29	71	159	1	93	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHS76674.1|GT32	2.54e-287	1	384	1	384
CAD6649868.1|GT32	3.05e-279	1	384	1	384
CAD6646231.1|GT32	3.05e-279	1	384	1	384
CAD6651252.1|GT32	7.78e-277	1	384	1	382
AJW21241.1|GT32	3.17e-276	1	384	1	382

PDB Hits     

QHS76674.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P33300|SUR1_YEAST	2.67e-275	1	384	1	382	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|P38287|CSH1_YEAST	7.00e-177	1	352	1	355	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	1.62e-84	12	288	15	316	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|Q10323|IMT3_SCHPO	6.41e-78	15	284	27	285	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|O14084|IMT1_SCHPO	1.43e-59	43	284	50	292	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999977	0.000052

TMHMM  Annotations     

Start	End
7	29
196	215
268	290