CAZyme Information: QHS73492.1

Basic Information

• Species: Saccharomyces paradoxus
• Lineage: Ascomycota; Saccharomycetes; ; Saccharomycetaceae; Saccharomyces; Saccharomyces paradoxus
• CAZyme ID: QHS73492.1
• CAZy Family: GH31
• CAZyme Description: Crh1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
494		51401.47	4.2468

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SparadoxusCBS432	5803	N/A	275	5528

• Gene Location: location=CP020248:846825-848309(-)

Full Sequence      

MKVLDLITVLSASSLFSILAAAESTATTDSATATSSAASCNPLKTTGCTPDTALATSFSE
DFSSSSKWFTDLKHAGEINYGSDGLSMTLAKRYDNPSLKSNFYIMYGKLEVILKAANGTG
IVSSFYLQSDDLDEIDIEWVGGDNTQFQSNFFSKGDTTTYDRGEFHGVDTPTDKFHNYTL
DWAMDKTTWYLDGESVRVLSNTSSEGYPQSPMYLMMGIWAGGDPDNAAGTIEWAGGETDY
NDAPFTMYIEKVIVTDYSTGKKYTYGDESGSWESIEADDGSIYGRYDQAQEDFAVLANGG
SISTSSASSSPSSSAASSTSSSVASSSSLSAASSTSSFAASSSSSSSTATPSKTSASSSV
TASSSISSSAKQSTSSSKKTVSSSSSGESTISSTKTSAIASSTTRSTVAPTSQQSSVSSD
SPVQDKGGVATSSNDKTSSTAQTSSEHTSTVQSSSSEVSSTNTVQIANGAKFAQSLPRQG
KLFSVLVTALLTFL

Enzyme Prediction     

EC	2.4.1.-:3	3.2.1.39:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	83	236	8.6e-73	0.9873417721518988

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185692	GH16_fungal_CRH1_transglycosylase	4.35e-108	74	258	15	203	glycosylphosphatidylinositol-glucanosyltransferase. Group of fungal GH16 members related to Saccharomyces cerevisiae Crh1p. Chr1p and Crh2p are transglycosylases that are required for the linkage of chitin to beta(1-3)glucose branches of beta(1-6)glucan, an important step in the assembly of new cell wall. Both have been shown to be glycosylphosphatidylinositol (GPI)-anchored. A third homologous protein, Crr1p, functions in the formation of the spore wall. They belongs to the family 16 of glycosyl hydrolases that includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
395585	Glyco_hydro_16	1.28e-58	75	235	3	168	Glycosyl hydrolases family 16.
185683	Glyco_hydrolase_16	3.20e-30	75	255	29	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
185684	GH16_lichenase	1.60e-23	68	252	24	208	lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure.
225182	BglS	7.31e-19	44	238	14	255	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHS73492.1|GH16_18	3.40e-239	1	494	1	494
AJR78281.1|GH16_18	6.66e-217	1	490	1	488
AJR97997.1|GH16_18	6.66e-217	1	490	1	488
AJP38960.1|GH16_18	6.66e-217	1	490	1	488
CAD6626485.1|GH16_18	3.22e-200	31	490	4	477

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6IBU_A	1.26e-79	40	278	4	245	Apo Crh5 transglycosylase [Aspergillus fumigatus Af293],6IBU_B Apo Crh5 transglycosylase [Aspergillus fumigatus Af293],6IBW_A Crh5 transglycosylase in complex with NAG [Aspergillus fumigatus Af293],6IBW_B Crh5 transglycosylase in complex with NAG [Aspergillus fumigatus Af293]
1MAC_A	2.07e-18	75	243	34	197	Crystal Structure And Site-Directed Mutagenesis Of Bacillus Macerans Endo-1,3-1,4-Beta-Glucanase [Paenibacillus macerans],1MAC_B Crystal Structure And Site-Directed Mutagenesis Of Bacillus Macerans Endo-1,3-1,4-Beta-Glucanase [Paenibacillus macerans]
1BYH_A	2.16e-18	75	243	36	199	MOLECULAR AND ACTIVE-SITE STRUCTURE OF A BACILLUS (1-3,1-4)-BETA-GLUCANASE [synthetic construct],1GLH_A Cation Binding To A Bacillus (1,3-1,4)-Beta-Glucanase. Geometry, Affinity And Effect On Protein Stability [Paenibacillus macerans],2AYH_A Crystal And Molecular Structure At 1.6 Angstroms Resolution Of The Hybrid Bacillus Endo-1,3-1,4-Beta-D-Glucan 4- Glucanohydrolase H(A16-M) [hybrid]
3D6E_A	4.14e-18	67	235	20	181	Crystal structure of the engineered 1,3-1,4-beta-glucanase protein from Bacillus licheniformis [Bacillus licheniformis],3D6E_B Crystal structure of the engineered 1,3-1,4-beta-glucanase protein from Bacillus licheniformis [Bacillus licheniformis]
1CPM_A	5.44e-18	93	276	1	178	NATIVE-LIKE IN VIVO FOLDING OF A CIRCULARLY PERMUTED JELLYROLL PROTEIN SHOWN BY CRYSTAL STRUCTURE ANALYSIS [Paenibacillus macerans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P53301|CRH1_YEAST	2.98e-200	1	490	1	504	Probable glycosidase CRH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CRH1 PE=1 SV=1
sp|Q5AFA2|CRH11_CANAL	1.03e-105	33	305	17	290	Extracellular glycosidase CRH11 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CRH11 PE=1 SV=1
sp|D4ALQ5|CRH11_ARTBC	5.99e-81	40	282	23	263	Probable extracellular glycosidase ARB_05253 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_05253 PE=1 SV=2
sp|Q8J0P4|CRF1_ASPFU	4.70e-77	40	282	25	269	Probable glycosidase crf1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=crf1 PE=1 SV=2
sp|Q5AK54|CRH12_CANAL	7.62e-68	40	283	43	288	Extracellular glycosidase CRH12 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CRH12 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.095930	0.904035	CS pos: 22-23. Pr: 0.8596

TMHMM  Annotations     

There is no transmembrane helices in QHS73492.1.