CAZyme Information: QHS73288.1

Basic Information

• Species: Saccharomyces paradoxus
• Lineage: Ascomycota; Saccharomycetes; ; Saccharomycetaceae; Saccharomyces; Saccharomyces paradoxus
• CAZyme ID: QHS73288.1
• CAZy Family: GH17
• CAZyme Description: Och1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
480	CP020248|CGC2	55017.44	7.3458

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SparadoxusCBS432	5803	N/A	275	5528

• Gene Location: location=CP020248:425922-427364(-)

Full Sequence      

MSRKLSHLIATRKSKTIVVTVLLVYSLLSFHLSNKRLLSQFYPSKNDYKQTRLPTTSHSQ
DINLKKQSAVNKKENQLHNLRDQLSFAFPYDAQAPIPQRVWQTWKVSTDNKDFPSTFRAY
QKTWADSSSPHYQYSLIPDDSIIPFLENLYAPVPVVVQAFKLMPKNILKADFLRYLLLFA
RGGVYSDMDTMLLKPIDSWPSQNESWLHNIIDVNKPIPYKNLKASPLSSDKISQQPGLVI
GIEADPDRDDWSVWYARRIQFCQWTIQAKPGHPILRELILNITATTLMSVQDPGVPVSEM
IDPRYEEDYNVNYRHKRRDDETYKHSELKNNKNVDGSDIMNWTGPGIFSDIIFEYMNNVL
RHNSDIMLVNPNLNKSDEEGSDGASALAEEFDGGALSKSTRRFYKKISESLQSSNLMPWE
FFSFLKDPVIVDDVMVLPITSFSPDVGQMGSQSSDDKMAFVKHMFGGTWKDDADKNAGHK

Enzyme Prediction     

EC	2.4.1.257:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	118	202	7.8e-20	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.71e-82	5	410	1	347	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	5.71e-20	114	206	1	93	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHS73288.1|GT32	0.0	1	480	1	480
AJR78072.1|GT32	0.0	1	480	1	480
AJP38751.1|GT32	0.0	1	480	1	480
AJR97789.1|GT32	0.0	1	480	1	480
CAD6625008.1|GT32	1.02e-312	1	480	1	480

PDB Hits     

QHS73288.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P31755|OCH1_YEAST	2.57e-313	1	480	1	480	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|Q5A4E3|OCH1_CANAL	2.26e-100	80	472	83	378	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|Q9UTR6|OCH1_SCHPO	4.52e-53	81	472	129	396	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P47124|HOC1_YEAST	7.61e-42	80	470	114	388	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|Q10323|IMT3_SCHPO	1.41e-06	94	197	55	150	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999978	0.000036

TMHMM  Annotations     

There is no transmembrane helices in QHS73288.1.