CAZyme Information: QHS72443.1

Basic Information

• Species: Saccharomyces paradoxus
• Lineage: Ascomycota; Saccharomycetes; ; Saccharomycetaceae; Saccharomyces; Saccharomyces paradoxus
• CAZyme ID: QHS72443.1
• CAZy Family: GH13
• CAZyme Description: Mnn10

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
393		46538.65	7.0965

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SparadoxusCBS432	5803	N/A	275	5528

• Gene Location: location=CP020245:921586-922767(+)

Full Sequence      

MSSVPYNSQLPISNHLDYDEEEKKSRGSKSGLKYKIIYWRKTLRNSLARWRKPILLISLA
LFLFIWISDSSISGGPSTTSFQGQNSNDNKLSNPGSSLNSKRYVPPYSKRSRWSFWNQDP
RIVIILAANEGGGVLRWKNEQEWAIEGISIENKKAYAKRHGYGLTIKDLTTSKRYSHEYR
EGWQKVDILRQTFREFPNAEWFWWLDLDTMIMEPSKSLEEHIFDRLETLADRELKSFNPL
NLKDDIPYVNYSEEMEFLITQDCGGFNLGSFLIKNSEWSKLLLDMWWDPVLYEQKHMVWE
HREQDALEALYENEPWIRSRIGFLTLRTINAFPPGACSEFSGDSRYFYSEKDHDFVVNMA
GCNFGRDCWGEMQYYTTLMEKLNRKWYTRFFFP

Enzyme Prediction     

No EC number prediction in QHS72443.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT34	120	370	1.6e-88	0.9878048780487805

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
368535	Glyco_transf_34	6.30e-106	118	368	1	238	galactosyl transferase GMA12/MNN10 family. This family contains a number of glycosyltransferase enzymes that contain a DXD motif. This family includes a number of C. elegans homologs where the DXD is replaced by DXH. Some members of this family are included in glycosyltransferase family 34.
215617	PLN03182	1.16e-05	149	286	152	265	xyloglucan 6-xylosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHS72443.1|GT34	4.33e-304	1	393	1	393
AJP37952.1|GT34	1.95e-291	1	393	1	393
AJV18899.1|GT34	1.95e-291	1	393	1	393
AJU78478.1|GT34	1.95e-291	1	393	1	393
AJV09175.1|GT34	1.95e-291	1	393	1	393

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6BSU_A	4.29e-07	149	286	59	172	Chain A, Xyloglucan 6-xylosyltransferase 1 [Arabidopsis thaliana],6BSU_B Chain B, Xyloglucan 6-xylosyltransferase 1 [Arabidopsis thaliana],6BSV_A Chain A, Xyloglucan 6-xylosyltransferase 1 [Arabidopsis thaliana],6BSV_B Chain B, Xyloglucan 6-xylosyltransferase 1 [Arabidopsis thaliana],6BSW_A Chain A, Xyloglucan 6-xylosyltransferase 1 [Arabidopsis thaliana],6BSW_B Chain B, Xyloglucan 6-xylosyltransferase 1 [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P50108|MNN10_YEAST	2.85e-291	1	393	1	393	Probable alpha-1,6-mannosyltransferase MNN10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN10 PE=1 SV=1
sp|P78817|YFE6_SCHPO	4.08e-99	118	386	71	340	Uncharacterized alpha-1,2-galactosyltransferase C637.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC637.06 PE=2 SV=2
sp|O94622|YBKD_SCHPO	6.16e-34	150	387	128	359	Uncharacterized alpha-1,2-galactosyltransferase C1289.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1289.13c PE=3 SV=1
sp|Q09174|GMA12_SCHPO	1.56e-31	121	386	103	358	Alpha-1,2-galactosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gma12 PE=1 SV=1
sp|Q10359|GMH3_SCHPO	2.97e-22	118	362	82	314	Alpha-1,2-galactosyltransferase gmh3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gmh3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999943	0.000040

TMHMM  Annotations     

There is no transmembrane helices in QHS72443.1.