CAZyme Information: QHS71721.1

Basic Information

• Species: Saccharomyces paradoxus
• Lineage: Ascomycota; Saccharomycetes; ; Saccharomycetaceae; Saccharomyces; Saccharomyces paradoxus
• CAZyme ID: QHS71721.1
• CAZy Family: CBM21
• CAZyme Description: Csh1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
375	CP020243|CGC3	44276.93	9.2564

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SparadoxusCBS432	5803	N/A	275	5528

• Gene Location: location=CP020243:571953-573080(+)

Full Sequence      

MRKELKILIIANIALLFSIIHYTFDLLTLCIDDTFKDALTDEELNPPKGFNSTLYESPPQ
LIPKIIHQTYKTNDIPEQWVKGRQKCIDLHPDYTYILWTDDMSDSFIKQEYPWFLDTFRS
YEYPIERADAIRYFILSHYGGIYIDLDDGCERRLDPLLTVPAFLRKTSPTGVSNDVMGSV
PRHPFFLKVIKSLKHYKKNWYIPYMTIMGSTGPLFISVVWKQYKRWSNTAENGAVRILQP
ADYKMHHNSFFSISKGSSWHTGDANFMKTLENHILSCVVTGFIFGFFILYGEYTFYTWLC
SGPFNNKRYYIQWLSDKFKLRKWKLTSFKDREKSRTLARHEYTSKGKRLRKDSNIPYDSV
FLDIEKNHAKFTDLT

Enzyme Prediction     

EC	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	79	158	1e-21	0.9333333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	6.20e-118	1	327	10	342	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	5.02e-27	76	158	1	87	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHS71721.1|GT32	1.25e-287	1	375	1	375
CAD6599866.1|GT32	1.61e-272	1	375	1	376
AJQ15838.1|GT32	9.32e-272	1	375	1	376
CAD6599581.1|GT32	9.32e-272	1	375	1	376
CAD6599747.1|GT32	1.88e-271	1	375	1	376

PDB Hits     

QHS71721.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P38287|CSH1_YEAST	1.36e-271	1	375	1	376	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|P33300|SUR1_YEAST	4.33e-177	1	369	1	372	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	1.51e-85	12	290	15	312	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|Q10323|IMT3_SCHPO	1.69e-84	50	290	45	285	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|O14084|IMT1_SCHPO	5.70e-52	62	290	64	292	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999653	0.000370

TMHMM  Annotations     

Start	End
7	29
200	219
274	296