CAZyme Information: QHS69635.1

Basic Information

• Species: [Candida] glabrata
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; [Candida] glabrata
• CAZyme ID: QHS69635.1
• CAZy Family: GT71
• CAZyme Description: MP65

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
371		38714.95	4.7453

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CglabrataCBS1382020	5508	N/A	250	5258

• Gene Location: location=CP048130:1367855-1368970(-)

Full Sequence      

MQFSKIITALSIAGAVIAAPANVHHEHKNKRDVVTKTVHNQVTVTAGAPPAVNTGLLKED
AVLGSSNEASAPVASSQAPAQQAAAPQSEAASPAPASSSQAAASSSAPKSSGSSSSFSGS
AKGITYSPYNADGSCRSASDVASDLAKLSSYSMIRLYGVDCNQVENVFKAKAAGQKLFLG
IFFVDQIQAGVDTMKAAVESYGSWDDVYTVSIGNELVNGGQATPDQVGQYVATGRSALKA
AGYSGPVVSVDTFIAVINNPALCQYSDYMAVNAHAYFDQNTVAEDAGTWLVQQIQRVWTA
CDGKKDVLITESGWPSQGETLGVAVASKQNQEAAIASIEKACGDDTILFTAFNDYWKADG
PYNCEKYWGIY

Enzyme Prediction     

No EC number prediction in QHS69635.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	130	371	1.1e-27	0.9356913183279743

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	5.15e-115	122	371	46	301	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	1.62e-08	130	371	11	297	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNG17311.1|GH17	1.94e-232	1	371	1	371
CAG62924.1|GH17	1.94e-232	1	371	1	371
QHS69635.1|GH17	1.94e-232	1	371	1	371
UCS39637.1|GH17	1.94e-232	1	371	1	371
UCS29177.1|GH17	1.94e-232	1	371	1	371

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	1.28e-09	132	370	46	281	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P53334|SCW4_YEAST	9.00e-143	122	370	134	382	Probable family 17 glucosidase SCW4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW4 PE=1 SV=1
sp|Q04951|SCW10_YEAST	4.37e-134	1	370	1	385	Probable family 17 glucosidase SCW10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW10 PE=1 SV=1
sp|Q59XX2|MP65_CANAL	3.99e-127	122	371	127	376	Cell surface mannoprotein MP65 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MP65 PE=1 SV=3
sp|P53189|SCW11_YEAST	9.33e-47	122	370	282	537	Probable family 17 glucosidase SCW11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW11 PE=1 SV=1
sp|Q4WC60|BTGE_ASPFU	1.28e-44	123	371	310	561	Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=btgE PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000283	0.999678	CS pos: 18-19. Pr: 0.9628

TMHMM  Annotations     

There is no transmembrane helices in QHS69635.1.