CAZyme Information: QHS69274.1

Basic Information

• Species: [Candida] glabrata
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; [Candida] glabrata
• CAZyme ID: QHS69274.1
• CAZy Family: GT71
• CAZyme Description: Mannosyl phosphorylinositol ceramide synthase SUR1 [Source:UniProtKB/TrEMBL;Acc:A0A0W0D410]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
441	CP048130|CGC5	51188.58	6.7152

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CglabrataCBS1382020	5508	N/A	250	5258

• Gene Location: location=CP048130:611739-613064(-)

Full Sequence      

MKKELKLLIYANFMLVVFILYYTFDLLMLCIDDTFQDALLDFELNPPRDRVTGLEVHDGK
PELIPKIIHQTYKTEDIPEQWKESQKKCIDLHPDYEYILWTDEMALKFIKEEYAWFLDTF
ENYKYPIQRADAIRYFILSHYGGIYIDLDDGCERRLDPLLKVPAFVRKTSPLGVSNNVMG
SVPRHPFYLKLLNSLKHYDKYWFIPYLTIMGSTGPLFVSVIWKQYKRWGVPENGVVRIMQ
PADYKKHTYSFFSISKGSSWHMDDAVFMKSLENHILSCVVAGFIVGFIILYGEYVFYCWL
CASWLGSSNDPEAESQDDEDDFIYNKGSQYYQQGHGSIFLGTSISPLRKLNKSLFSTLYT
KLVPSSSSSSASACSVSEKYSTPKLSRSVAEYYSLRKENSVHFNSPTPKGKRSRKDSNVR
FTNFLLSDIEKLDPNVEDLTN

Enzyme Prediction     

EC	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	80	161	3.5e-23	0.9555555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	6.29e-102	1	313	10	336	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.30e-27	78	160	1	87	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAG62566.1|GT32	0.0	1	441	1	441
QNG16952.1|GT32	0.0	1	441	1	441
QHS69274.1|GT32	0.0	1	441	1	441
UCS34047.1|GT32	0.0	1	441	1	441
UCS23587.1|GT32	0.0	1	441	1	441

PDB Hits     

QHS69274.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P33300|SUR1_YEAST	2.45e-174	1	302	1	293	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|P38287|CSH1_YEAST	6.30e-166	1	302	1	301	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	1.37e-83	47	291	66	312	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|Q10323|IMT3_SCHPO	1.33e-80	49	291	42	285	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|O14084|IMT1_SCHPO	6.40e-55	59	291	59	292	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999883	0.000141

TMHMM  Annotations     

Start	End
7	29
202	221
275	297