CAZyme Information: QHS66919.1

Basic Information

• Species: [Candida] glabrata
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; [Candida] glabrata
• CAZyme ID: QHS66919.1
• CAZy Family: GT2
• CAZyme Description: Glucan 1,3-beta-glucosidase I/II [Source:UniProtKB/TrEMBL;Acc:A0A0W0D2R9]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
443	CP048126|CGC4	51158.09	4.5510

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CglabrataCBS1382020	5508	N/A	250	5258

• Gene Location: location=CP048126:36595-37926(-)

Full Sequence      

MVSFSFATIVAALSVSALAKPVIAPKNKDTSLHFVNEKRYYDYDSKAIGEPIRGVNIGGW
FVLEPYITPSLFEAFRTNPYNDDGIPVDEYHYCEQLGEQEARNRLEYHWSTFYTEQDFAD
IKSKGFNLVRIPIGYWAFKDMPNDPYVKGSQEYYLDQAIQWAENNGLKVWVDLHGAVGSQ
NGFDNSGLRDSIDFLADENLQNTKEILKYVLQKYSQQQYLNTVIGVELINEPLGPVIDMD
KMKEQYIKPAYEYLRNELQSIQDIIVHDAFQPFHYWDDFMTVDTGYWGVVIDHHHYQVFS
TGELQRDMGQHIQVACEWGSGILTESHWTVAGEWSAALTDCTKWLNGVGIGARYDGSFWK
NGVSSSFIGSCANNEDIYSWSEERKENTRKYIEAQLDAFEKRGGWIFWCYKTETNIEWDA
SRLIEYGMFPQPLTDRRYPGQCA

Enzyme Prediction     

EC	3.2.1.58:29	3.2.1.21:6	3.2.1.75:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	108	413	8e-126	0.9933993399339934

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	4.31e-104	37	442	3	394	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	6.70e-10	109	234	19	133	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAG60211.1|GH5_9	0.0	1	443	1	443
QNG15968.1|GH5_9	0.0	1	443	1	443
QHS66919.1|GH5_9	0.0	1	443	1	443
UCS27835.1|GH5_9	0.0	1	443	1	443
UCS33064.1|GH5_9	0.0	1	443	1	443

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1H4P_A	3.14e-232	40	443	1	404	Crystal structure of exo-1,3-beta glucanse from Saccharomyces cerevisiae [Saccharomyces cerevisiae],1H4P_B Crystal structure of exo-1,3-beta glucanse from Saccharomyces cerevisiae [Saccharomyces cerevisiae]
1EQP_A	1.32e-168	41	443	2	392	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
1CZ1_A	1.87e-168	41	443	2	392	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
2PB1_A	2.31e-168	41	443	8	398	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]
2PBO_A	6.58e-168	41	443	8	398	Chain A, Hypothetical protein XOG1 [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P23776|EXG1_YEAST	3.00e-239	16	443	16	444	Glucan 1,3-beta-glucosidase I/II OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=EXG1 PE=1 SV=1
sp|Q876J3|EXG_SACU7	2.45e-238	16	442	16	443	Glucan 1,3-beta-glucosidase OS=Saccharomyces uvarum (strain ATCC 76518 / CBS 7001 / CLIB 283 / NBRC 10550 / MCYC 623 / NCYC 2669 / NRRL Y-11845) OX=659244 GN=EXG1 PE=3 SV=1
sp|Q875R9|EXG_LACK1	3.91e-228	17	443	16	438	Glucan 1,3-beta-glucosidase OS=Lachancea kluyveri (strain ATCC 58438 / CBS 3082 / BCRC 21498 / NBRC 1685 / JCM 7257 / NCYC 543 / NRRL Y-12651) OX=226302 GN=EXG1 PE=3 SV=1
sp|P32603|SPR1_YEAST	1.76e-216	1	442	1	444	Sporulation-specific glucan 1,3-beta-glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SPR1 PE=2 SV=1
sp|Q876J2|SPR1_SACU7	9.62e-214	1	442	1	444	Sporulation-specific glucan 1,3-beta-glucosidase OS=Saccharomyces uvarum (strain ATCC 76518 / CBS 7001 / CLIB 283 / NBRC 10550 / MCYC 623 / NCYC 2669 / NRRL Y-11845) OX=659244 GN=SPR1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000299	0.999665	CS pos: 19-20. Pr: 0.9767

TMHMM  Annotations     

There is no transmembrane helices in QHS66919.1.