CAZyme Information: QHS66011.1

Basic Information

• Species: [Candida] glabrata
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; [Candida] glabrata
• CAZyme ID: QHS66011.1
• CAZy Family: GH63
• CAZyme Description: SCW4

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
374	CP048124|CGC1	39448.76	5.1374

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CglabrataCBS1382020	5508	N/A	250	5258

• Gene Location: location=CP048124:46344-47468(+)

Full Sequence      

MKFSTLITSALLGTAIAAPHAAHTHKEKRDVVTKTMHAVQTVVVGPDGTPVQKAEAINEQ
VVENAPQPTTQQQQQQQQQASPAPAKSTTELAPASSPASSSSSSSSSNTKKPDTQVGGAG
VKGITYTPYNADGTCKDASAVASDLAALSQYPTIRLYGTDCNQVENVFKAKASGQKLFLG
VFDVSNIQGSVDAIKSAVNTYGSWDDVTTVSIGNELVNGGQASPAQVGQYVAAGRAALQA
AGFNGPVVSVDTFIAVINNPELCQYSEYMAVNAHAYFDQYTKAQDAGSWLLQQIQRVWTA
CDGKKEVVITESGWPSKGQTLGVAVPSKQNQKDAVNSITAACGADTFLYNAFNDYWKADG
PYGCEKYWGVLSDE

Enzyme Prediction     

No EC number prediction in QHS66011.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	130	372	4e-29	0.9389067524115756

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	1.77e-108	118	374	42	304	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	4.46e-09	130	372	11	298	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAG59305.1|GH17	3.56e-241	1	374	1	374
QHS66011.1|GH17	3.56e-241	1	374	1	374
UCS36039.1|GH17	1.02e-240	1	374	1	374
UCS20349.1|GH17	1.02e-240	1	374	1	374
UCS30810.1|GH17	1.02e-240	1	374	1	374

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	1.03e-07	132	374	46	285	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P53334|SCW4_YEAST	4.63e-146	119	374	131	386	Probable family 17 glucosidase SCW4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW4 PE=1 SV=1
sp|Q04951|SCW10_YEAST	3.95e-128	1	374	1	389	Probable family 17 glucosidase SCW10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW10 PE=1 SV=1
sp|Q59XX2|MP65_CANAL	3.31e-119	111	373	116	378	Cell surface mannoprotein MP65 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MP65 PE=1 SV=3
sp|P53189|SCW11_YEAST	5.21e-46	122	372	282	539	Probable family 17 glucosidase SCW11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW11 PE=1 SV=1
sp|B0Y9Q9|BTGE_ASPFC	1.91e-44	119	372	306	562	Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=btgE PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000229	0.999758	CS pos: 29-30. Pr: 0.3590

TMHMM  Annotations     

There is no transmembrane helices in QHS66011.1.