CAZyme Information: QHS64723.1

Basic Information

• Species: [Candida] glabrata
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; [Candida] glabrata
• CAZyme ID: QHS64723.1
• CAZy Family: GT91
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
273	CP048119|CGC1	31109.72	5.2454

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CglabrataCBS1382020	5508	N/A	250	5258

• Gene Location: location=CP048119:299208-300029(+)

Full Sequence      

MIHSELVVRLDNPSLESPNTEQEKALSSYYTYGGLHYADNGVYVINKKQAFEGLLGAATL
LSHKKYRRCSDGENEFMWLGMFTVGNNFVSDSIDAGILGEIKLESEGPRRGYAYVCGTQV
SHSDDVGRLVWSKDGLVTCKFENAAHEDFSRDSQYFTDRYLDEHNLDEIYKSKLNINGFI
VPDTRKNPWKQISECRATMYCAYIPHLKSNTDDEGGILASFGGGYLTHIKDVVNARLEPS
ERERRELQAKIDKERQELEQIEHQLEEVGHIVR

Enzyme Prediction     

No EC number prediction in QHS64723.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
402574	Mannosyl_trans3	1.56e-12	18	124	164	273	Mannosyltransferase putative. This family is conserved in fungi. Several members are annotated as being alpha-1,3-mannosyltransferase but this could not be confirmed.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHS64723.1|GT71	4.75e-202	1	273	1	273
UCS19056.1|GT71	1.23e-193	1	273	425	697
UCS24289.1|GT71	1.23e-193	1	273	425	697
UCS29519.1|GT71	1.23e-193	1	273	425	697
UCS34748.1|GT71	1.23e-193	1	273	425	697

PDB Hits     

QHS64723.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P40549|MNT3_YEAST	6.38e-45	19	232	403	623	Alpha-1,3-mannosyltransferase MNT3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNT3 PE=1 SV=1
sp|P53745|MNT4_YEAST	5.50e-19	36	203	388	549	Probable alpha-1,3-mannosyltransferase MNT4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNT4 PE=3 SV=1
sp|P39106|MNN1_YEAST	2.81e-15	6	202	490	697	Alpha-1,3-mannosyltransferase MNN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN1 PE=1 SV=1
sp|P53059|MNT2_YEAST	4.50e-15	36	201	362	525	Alpha-1,3-mannosyltransferase MNT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNT2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000042	0.000001

TMHMM  Annotations     

There is no transmembrane helices in QHS64723.1.