CAZyme Information: QEO21563.1

Basic Information

• Species: [Candida] auris
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; [Candida] auris
• CAZyme ID: QEO21563.1
• CAZy Family: GT15|GT15
• CAZyme Description: hypothetical_protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
338		39545.79	8.4078

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CaurisB11220	5494	N/A	167	5327

• Gene Location: location=CP043532:2093128-2094144(+)

Full Sequence      

MRKELKFILWGHAALIAFLVYCSYDLISLLFDDSFQDDLLDVELNPADGRIDKPNVIPKI
IHQTYKDEHIPKLWQPGQEACVELHPDYQYILWTDNSAREFIAEEYPWFLETWDSYPYPI
QRADAIRYFALAHYGGIYIDLDDGCVRRLDPLLTVPAFVRQTVPTGISNDVMGAVPKHPF
FIKVLDNLKKYKRNWLVPYITIMFSTGPLFLSVMLQQYKRYGVPEAAKVRILLPRDYKTH
EFSFFAISPGSSWHLDDAKFVKSLANHIGLAVFGGFIIASLFLLLEWYFYQWCVHTNFTK
SLERLQAKVRWRRIVKRRSRKDSNLPAQVNISKEQNIV

Enzyme Prediction     

EC	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	73	153	2.4e-24	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.39e-72	6	292	13	317	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	2.23e-26	71	153	1	87	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEO21563.1|GT32	5.05e-257	1	338	1	338
QRG37334.1|GT32	8.37e-256	1	338	1	338
QWW21445.1|GT32	8.37e-256	1	338	1	338
QWU89714.1|GT32	5.05e-232	1	338	1	338
SGZ58833.1|GT32	3.55e-202	1	335	1	335

PDB Hits     

QEO21563.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P33300|SUR1_YEAST	3.36e-128	1	311	1	312	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|P38287|CSH1_YEAST	9.67e-124	1	292	1	298	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	2.82e-84	56	291	81	316	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|Q10323|IMT3_SCHPO	2.52e-82	29	277	28	278	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|O14084|IMT1_SCHPO	1.79e-57	47	285	57	293	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.998480	0.001549

TMHMM  Annotations     

Start	End
7	29
195	214
268	290