CAZyme Information: QEO21484.1

Basic Information

• Species: [Candida] auris
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; [Candida] auris
• CAZyme ID: QEO21484.1
• CAZy Family: GT1
• CAZyme Description: hypothetical_protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
363	CP043532|CGC8	37666.58	5.8341

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CaurisB11220	5494	N/A	167	5327

• Gene Location: location=CP043532:1898803-1899894(-)

Full Sequence      

MLFKSFVSAALAATALAQPVQHQHHQHDKKAVVVTNWNTVVVTATAGAAPAAQPTQDAEA
NAAAAVGTTLATKPSPVASSSSSSGSGSSPASSSSDSVSVPSSSGSFSGPAKGITYSPYS
DDGGCKSASQIKSEVSKLSGYEVIRLYGVDCNQVEATLSGLSSGQKIFAGIFDVDNIESG
VETLAKAVKNHGGWDVVHTVSIGNELVNAGSATPDQIGKYIESGRSALKAQGYNGPVVSV
DTFIAVINNPDLCKHSDYMAVNAHAFFDGYVSAKEAGDWALLQLQRVSNACGDSKKVFIT
ETGWPTKGDSNNVAVPSKENQKAALDSISAKCGSDATFFNAYNDMWKQPGPYNAEQYWGV
YSS

Enzyme Prediction     

No EC number prediction in QEO21484.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	113	362	1.1e-24	0.9581993569131833

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	2.24e-94	112	363	46	303	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	2.18e-04	121	363	12	299	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEO21484.1|GH17	1.06e-195	1	363	1	363
QRG37253.1|GH17	1.06e-195	1	363	1	363
QWW21518.1|GH17	1.06e-195	1	363	1	363
QEL58275.1|GH17	1.06e-195	1	363	1	363
QWU89642.1|GH17	1.22e-169	100	363	103	366

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	4.75e-11	113	363	39	284	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59XX2|MP65_CANAL	1.70e-131	103	363	118	378	Cell surface mannoprotein MP65 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MP65 PE=1 SV=3
sp|Q04951|SCW10_YEAST	1.22e-108	111	363	136	388	Probable family 17 glucosidase SCW10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW10 PE=1 SV=1
sp|P53334|SCW4_YEAST	3.15e-108	106	363	128	385	Probable family 17 glucosidase SCW4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW4 PE=1 SV=1
sp|P53189|SCW11_YEAST	9.87e-52	112	360	282	537	Probable family 17 glucosidase SCW11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW11 PE=1 SV=1
sp|A1C499|BTGE_ASPCL	5.41e-46	104	359	302	559	Probable beta-glucosidase btgE OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=btgE PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000347	0.999627	CS pos: 17-18. Pr: 0.9584

TMHMM  Annotations     

There is no transmembrane helices in QEO21484.1.