CAZyme Information: QEO21230.1

Basic Information

• Species: [Candida] auris
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; [Candida] auris
• CAZyme ID: QEO21230.1
• CAZy Family: GH76
• CAZyme Description: hypothetical_protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1082	CP043532|CGC9	120028.30	5.0152

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CaurisB11220	5494	N/A	167	5327

• Gene Location: location=CP043532:1322618-1325866(+)

Full Sequence      

MVLATLVLLFTLFLSLPVLGFPVYVRTPYSFKETSPSVNGDDELKSLRDLVVSRENKQIF
TNLLFADNAYYDKSTHTLGTLDWVPHHQYQRQPYVANGYLGSRIPNLGQGFAYDTLSNGT
FVGVDTPDAELPSDLSNGWPLFNRRYAGAFVAGFYDLQKNTTMTNFPWLLQDGYESVVAA
VPQWTSLALSAEKNSKKYKLDPSGTPDSFGRISNYAQNLSMTDGVVTTSFTWLDSFKVTY
KVLAHRDKINLGLVHLEVENVGISNATLAVHDLLDFSSAQRARFNATSVDKDNKGIYMLY
SPNDIDYVFGATYSSLRYGSSDGSSEESADARCVGAEFTTSEISSGQTLTFEMPTGSSLK
VSKHVGIVTSDLDPEHYTSFHSVLEKARSVSLEDEDFTSLAESHANSWDAVVNQGLKVEF
PDNPLLTLAARASIYHLNANTRSDATGLTAAMSVTGLSSDSYGGMVFWDTDLWMMNGLLP
FSPSHARSFVNYRLHTHEQARKNLESDYAPKKDMNGAAYPWTSGRFGNCTSTGPCFDYEY
HINMAVAIAAWELYKSGAVDDHFLEHSAYPLIDDAAAFFADYVQYNETLHAYSTHNLTDP
DEFANHVDNGAYTNAAISATMKWAAAVSEHLGKPVPKAYKDIMDNMHLPRSIDDPDIILE
FTGMNSSIGIKQADVVMITYPLENEMITHQSAKASMEYASMKQVSFGPAMTFPIFSIVSS
ALSEKGCSSDTYLVKAIQPFLRGPFAQFSEQNNDDYLTNGGTHPAFPFMTAHGGFLQAIL
QGILGLRFAHKMDNGKIVRYLKLDPIKLKTFPQGVHFDGVHYLNQTLSFNLTSSGLVVKH
NGPTQGSVPHKVLIEVSDRNPKAGSYTLMPGTDVQLQLYETEFSYEDSLSECGRALFTNI
TECAPGDSPILANDGDNTTHWQAKSSEKSKVLIEFTEPTQFQNCTINWGDRPPKRVYLSA
AAQDLSSEYTNLQETIDFLSNVDFGTQLPKRYQFNNPSGKLYKQKDIFATVASKDVGINE
PFSPEEQSLIVLPTRHNTTEIVLDSPIKTRFALIEFEGLHDKIDKNDEESQKGAKIFELN
FF

Enzyme Prediction     

EC	3.2.1.28:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH65	431	790	5.2e-88	0.9946236559139785

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224471	ATH1	1.36e-81	95	831	32	733	Trehalose and maltose hydrolase (possible phosphorylase) [Carbohydrate transport and metabolism].
281612	Glyco_hydro_65m	8.36e-37	431	797	1	387	Glycosyl hydrolase family 65 central catalytic domain. This family of glycosyl hydrolases contains vacuolar acid trehalase and maltose phosphorylase.Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes the conversion of maltose and inorganic phosphate into beta-D-glucose-1-phosphate and glucose. The central domain is the catalytic domain, which binds a phosphate ion that is proximal the the highly conserved Glu. The arrangement of the phosphate and the glutamate is thought to cause nucleophilic attack on the anomeric carbon atom. The catalytic domain also forms the majority of the dimerization interface.
397616	Glyco_hydro_65N	3.28e-23	87	370	11	240	Glycosyl hydrolase family 65, N-terminal domain. This family of glycosyl hydrolases contains vacuolar acid trehalase and maltose phosphorylase.Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes the conversion of maltose and inorganic phosphate into beta-D-glucose-1-phosphate and glucose. This domain is believed to be essential for catalytic activity although its precise function remains unknown.
237517	PRK13807	1.07e-13	212	660	106	552	maltose phosphorylase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEO21230.1|GH65	0.0	1	1082	1	1082
QWW21864.1|GH65	0.0	1	1082	20	1101
QEL58660.1|GH65	0.0	1	1082	1	1082
QRG36869.1|GH65	0.0	1	1082	1	1082
QWU86795.1|GH65	0.0	1	1082	1	1068

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7FE3_A	2.68e-40	151	786	62	640	Chain A, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE3_B Chain B, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE3_C Chain C, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_A Chain A, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_B Chain B, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_C Chain C, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101]
3WIQ_A	4.17e-20	402	839	284	737	Crystal structure of kojibiose phosphorylase complexed with kojibiose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_A Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_B Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_C Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_D Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903]
4KTP_A	2.75e-16	345	663	221	549	Chain A, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTP_B Chain B, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10]
4KTR_A	3.62e-16	345	663	221	549	Chain A, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_B Chain B, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_C Chain C, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_D Chain D, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_E Chain E, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_F Chain F, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_G Chain G, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_H Chain H, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AAU5|ATC1_CANAL	0.0	28	1082	61	1078	Cell wall acid trehalase ATC1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ATC1 PE=1 SV=2
sp|M1RNJ8|ATH1_CANGB	2.81e-217	54	1079	145	1208	Periplasmic/secreted acid trehalase ATH1 OS=Candida glabrata OX=5478 GN=ATH1 PE=1 SV=1
sp|N1P212|ATH1_YEASC	5.46e-209	56	1079	111	1207	Periplasmic acid trehalase ATC1 OS=Saccharomyces cerevisiae (strain CEN.PK113-7D) OX=889517 GN=CENPK1137D_1727 PE=1 SV=1
sp|P48016|ATH1_YEAST	5.46e-209	56	1079	111	1207	Periplasmic acid trehalase ATH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ATH1 PE=1 SV=1
sp|P78617|TREA_EMENI	9.13e-121	89	953	76	935	Acid trehalase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=treA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000244	0.999756	CS pos: 20-21. Pr: 0.9790

TMHMM  Annotations     

Start	End
2	24