CAZyme Information: QEO20416.1

Basic Information

• Species: [Candida] auris
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; [Candida] auris
• CAZyme ID: QEO20416.1
• CAZy Family: GH17
• CAZyme Description: hypothetical_protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
308		33852.66	4.2883

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CaurisB11220	5494	N/A	167	5327

• Gene Location: location=CP043531:2641151-2642123(+)

Full Sequence      

MKFNIFAAATIFTSTVAGLGDLAFSLGVKDNSGNCKTADEYKQDFSVLSSHSKIVRTYAV
SDCNTLENLGPAAEEAGFQVMFGIWPTDEAHFGAEKEALKTFLPKISKSTVKVFTVGSEA
LYRDDMSASDLANAINEVKQLLSEIKDKNGESYKDVQVGTADSWNVLVDGGSLPAIKAAD
FVFANAFSYWQGQTKENASYSFVDDIMQALQTIQTAKGSTDLGNFWVGETGWPTQGTHFE
ASEPSVENAKNYWKEAICAIRAWGVNVCVFEAFDEAWKPDTSGTSDVEKYWGVWEENYSL
KYPLSCEF

Enzyme Prediction     

EC	3.2.1.39:6	3.2.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	24	306	1.3e-43	0.9903536977491961

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	1.75e-96	13	297	37	304	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	1.20e-88	22	306	1	309	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRG39171.1|GH17	4.69e-231	1	308	1	308
QEO20416.1|GH17	4.69e-231	1	308	1	308
QEL61524.1|GH17	1.34e-230	1	308	1	308
QWW23876.1|GH17	1.98e-221	1	305	1	305
QWU88852.1|GH17	1.19e-195	1	307	1	307

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	6.36e-38	27	307	43	295	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	4.81e-37	27	307	43	295	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AMT2|BGL2_CANAL	2.61e-150	9	308	10	307	Glucan 1,3-beta-glucosidase BGL2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=BGL2 PE=1 SV=2
sp|P43070|BGL2_CANAX	1.01e-147	9	308	10	307	Glucan 1,3-beta-glucosidase OS=Candida albicans OX=5476 GN=BGL2 PE=3 SV=1
sp|P15703|BGL2_YEAST	5.08e-142	7	308	11	312	Glucan 1,3-beta-glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BGL2 PE=1 SV=1
sp|O13990|BGL2_SCHPO	1.91e-84	7	306	25	318	Glucan 1,3-beta-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bgl2 PE=2 SV=4
sp|D4B2W4|BGL2_ARTBC	2.69e-64	8	307	10	302	Glucan 1,3-beta-glucosidase ARB_02797 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_02797 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001913	0.998071	CS pos: 18-19. Pr: 0.9506

TMHMM  Annotations     

There is no transmembrane helices in QEO20416.1.