CAZyme Information: QEO19356.1

Basic Information

• Species: [Candida] auris
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; [Candida] auris
• CAZyme ID: QEO19356.1
• CAZy Family: AA1
• CAZyme Description: hypothetical_protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
330	CP043531|CGC18	36012.60	6.3598

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CaurisB11220	5494	N/A	167	5327

• Gene Location: location=CP043531:272300-273292(+)

Full Sequence      

MSIPEKVNLTTGTGWGSGPCVGNTGSVPRLGIPSLCLQDGPNGVRFTDFVTHFPSGLAAA
STFNKELVYKRGKAIGREHRSKGVHIALGPSIGPIGLKAKGGRNWESFGADPYLQGIMGA
QTVKGIQEEGVVAVAKHLIGNEQEHFRQVGEWDHGDYDRLDSSISSNIGDRAMHEVYLWP
FADVIKAGVGGIMCAYNMVNNTYACENSQLLNYLLKEELAFQGFVVSDWGAQHTGVTSAL
SGLDMTMPGEVFDDWLGGKSYWGPLLTRAVYNKTIPQDRLNDMAARILAPFFSSEHLSLP
SCEEVPNFSSWTHHTYGQQYPYQHFGAIVQ

Enzyme Prediction     

EC	3.2.1.21:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	26	248	1.3e-62	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	2.76e-46	28	289	56	310	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	1.48e-33	29	288	63	314	Glycosyl hydrolase family 3 N terminal domain.
185053	PRK15098	1.38e-26	29	258	101	330	beta-glucosidase BglX.
178629	PLN03080	2.28e-16	23	231	72	300	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEO19356.1|GH3	1.23e-253	1	330	1	330
QWW22787.1|GH3	1.05e-239	1	330	1	330
QRG35807.1|GH3	1.14e-239	1	330	1	330
QEL59728.1|GH3	1.14e-239	1	330	1	330
QWU85892.1|GH3	1.12e-213	1	330	704	1033

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6SZ6_A	1.66e-123	1	317	34	342	Chain A, Beta-glucosidase [Thermochaetoides thermophila]
5FJJ_A	9.92e-120	1	317	36	346	Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_B Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_C Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_D Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae]
5NBS_A	1.40e-119	1	317	50	361	Structural studies of a Glycoside Hydrolase Family 3 beta-glucosidase from the Model Fungus Neurospora crassa [Neurospora crassa OR74A],5NBS_B Structural studies of a Glycoside Hydrolase Family 3 beta-glucosidase from the Model Fungus Neurospora crassa [Neurospora crassa OR74A]
4IIB_A	2.10e-118	1	326	35	354	Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus [Aspergillus aculeatus],4IIB_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus [Aspergillus aculeatus],4IIC_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with isofagomine [Aspergillus aculeatus],4IIC_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with isofagomine [Aspergillus aculeatus],4IID_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with 1-deoxynojirimycin [Aspergillus aculeatus],4IID_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with 1-deoxynojirimycin [Aspergillus aculeatus],4IIE_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with calystegine B(2) [Aspergillus aculeatus],4IIE_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with calystegine B(2) [Aspergillus aculeatus],4IIF_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with castanospermine [Aspergillus aculeatus],4IIF_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with castanospermine [Aspergillus aculeatus],4IIG_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with D-glucose [Aspergillus aculeatus],4IIG_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with D-glucose [Aspergillus aculeatus],4IIH_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with thiocellobiose [Aspergillus aculeatus],4IIH_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with thiocellobiose [Aspergillus aculeatus]
5FJI_A	1.24e-117	1	320	35	349	Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus fumigatus],5FJI_B Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus fumigatus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P22506|BGL1_SACFI	2.48e-145	1	330	68	395	Beta-glucosidase 1 OS=Saccharomycopsis fibuligera OX=4944 GN=BGL1 PE=3 SV=1
sp|P22507|BGL2_SACFI	5.32e-142	1	320	70	389	Beta-glucosidase 2 OS=Saccharomycopsis fibuligera OX=4944 GN=BGL2 PE=3 SV=1
sp|A1CMH6|BGLE_ASPCL	2.31e-120	1	312	237	545	Probable beta-glucosidase E OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglE PE=3 SV=1
sp|Q0CTD7|BGLA_ASPTN	3.65e-120	1	317	55	365	Probable beta-glucosidase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglA PE=3 SV=1
sp|D0VKF5|BGLA_ASPTE	7.23e-120	1	317	55	365	Probable beta-glucosidase A OS=Aspergillus terreus OX=33178 GN=bglA PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000031	0.000026

TMHMM  Annotations     

There is no transmembrane helices in QEO19356.1.