CAZyme Information: QEL59437.1

Basic Information

• Species: [Candida] auris
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Candida; [Candida] auris
• CAZyme ID: QEL59437.1
• CAZy Family: GH3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
505	CP043442|CGC10	56985.57	5.5365

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CaurisB11245	5675	N/A	169	5506

• Gene Location: location=CP043442:3243453-3244970(+)

Full Sequence      

MGLSKLVDKMRAHSVDSVNAADPPVTAGQPPTKKQIYRARYNFGPNFGACFVGEKWIFHS
PFPEGANTELEAAEKNIKELGKDGAREKLENHWKSYVNDDDWQWLKDNGVTAIRLPIGYW
NIDGGKYTKGTKFEKVADIYKNSWEIVKKNFIEPAGRFDIGVLIDVHGLPYGANGNDHSG
ESANGKAEFWEKKSAQSLMIDALKFVAGDVAQYENIAGIQIVNESEFSETAGKQKKYYAE
AINAIRSVDKSVPVVISDGWWPDQWAKWVQENQDIGTTIGVVIDHHVYRCFDDKDKCKSP
EQITNDLDGDLLTNINDDGNGVDFMVGEWSCVLDGQTISKAGLDPNDYGNQKRAELTGQY
GAKVADLIFKRAGGGCFFWTYKFESGNGGEWDFRQQLHHSFSPPAITVPDDNKFQELLDG
NLKAHTDYWNSQNPKEKYEHDRYKEGFTAAWKDSVEFAKQGSLLGRRQAVKCARLKEHID
AKGKSKFLWEWEQGYDKAIEEFNKL

Enzyme Prediction     

No EC number prediction in QEL59437.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	88	389	3.8e-122	0.9965870307167235

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	2.04e-28	30	308	6	262	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	3.63e-04	94	261	21	170	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEL59437.1|GH5_49	0.0	1	505	1	505
QEO19646.1|GH5_49	0.0	1	505	1	505
QWW22528.1|GH5_49	0.0	1	505	1	505
QRG36096.1|GH5_49	0.0	1	505	1	505
QWU86148.1|GH5_49	0.0	1	505	1	505

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EQP_A	3.52e-18	44	407	11	383	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
1CZ1_A	4.72e-18	44	407	11	383	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
2PB1_A	4.95e-18	44	407	17	389	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]
3O6A_A	8.82e-18	44	407	16	388	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
2PC8_A	1.19e-17	44	407	17	389	Chain A, Hypothetical protein XOG1 [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P38081|YBQ6_YEAST	2.72e-103	30	504	30	500	Uncharacterized glycosyl hydrolase YBR056W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YBR056W PE=1 SV=1
sp|O74799|EXG3_SCHPO	4.92e-90	33	498	5	448	Glucan 1,3-beta-glucosidase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=exg3 PE=3 SV=1
sp|B8N151|EXGA_ASPFN	3.82e-26	44	414	33	401	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=exgA PE=3 SV=1
sp|Q7Z9L3|EXGA_ASPOR	3.82e-26	44	414	33	401	Glucan 1,3-beta-glucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=exgA PE=1 SV=1
sp|A1CRV0|EXGA_ASPCL	7.62e-24	9	407	26	406	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=exgA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000050	0.000000

TMHMM  Annotations     

There is no transmembrane helices in QEL59437.1.