CAZyme Information: PYU1_T013487-p1

Basic Information

• Species: Globisporangium ultimum
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium ultimum
• CAZyme ID: PYU1_T013487-p1
• CAZy Family: GT71
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
587	PultDAOMBR144_SC1924|CGC1	65551.83	6.5010

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GultimumDAOMBR144	15430	431595	140	15290

• Gene Location: location=PultDAOMBR144_SC1924:173632-175395(+)

Full Sequence      

MKCTRFLLLGAAAALASVQAHNNVAVTTASTVNADAKRCFPDDFLFGTATASYQVEGGWN
ETGRTTSIWDDFCRERPGLDCANVADDFLHRYRDDIDLMSSTGLDSFRFSISWSRLMNWD
AETKKMKPNAPGIAFYHSLIDELRRKHIVPILTLYHWDLPSELHRELQPQGWINPAIVDH
FVQYADLVFSEFGSKIDYWTTFNEPWSFIVNGYGTGGHAPGFRGSKTDTYIAAHNMLISH
GKAVQLFRKLKKSGAIHDKARIGIVLISEYGYPKDPTNAADVAAASRKLEFSVGWFLTPL
VSGKYPDIMRERVGDRLPEFTQEEAALVKGSYDLFMLNHYSSKTVTDCSSERSTIKCADQ
SPGWESDLGIDDTGAPEGARLSSLNDLGQHNCVWFAGYSPGYLEIIKWTHAHDPNADILL
TENGWCGNDTIENMDQLWYYQTYLGQVHKAITEFKIPVIGYTAWSFVDNYEWGSFKPRFG
LYYVNFTSQTGSKDGYVPKATDLARIPRPAAKWYQKVSETKCLDGFETESAAAGAQSSAA
QLKTPAENDAYSSSSKTVLIVVLCVVVAVPAVAWLVKRSRRSGYSRV

Enzyme Prediction     

EC	3.2.1.21:2	3.2.1.23:1	3.2.1.38:1	3.2.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	37	521	2.4e-138	0.9906759906759907

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395176	Glyco_hydro_1	6.31e-148	40	521	5	451	Glycosyl hydrolase family 1.
274539	BGL	1.16e-128	41	514	1	426	beta-galactosidase.
225343	BglB	8.73e-121	40	524	4	456	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
215435	PLN02814	1.73e-95	24	514	12	476	beta-glucosidase
215455	PLN02849	2.98e-89	40	514	30	476	beta-glucosidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EGZ16993.1|GH1	2.09e-246	8	532	7	523
UIZ29641.1|GH1	9.23e-237	39	523	12	496
CCA20215.1|GH1	2.47e-222	26	524	9	507
UIZ29273.1|GH1	4.15e-157	88	526	5	421
AOW17800.1|GH1	5.90e-107	40	521	4	456

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WQ4_A	5.46e-95	26	516	25	503	Crystal structure of beta-primeverosidase [Camellia sinensis],3WQ4_B Crystal structure of beta-primeverosidase [Camellia sinensis],3WQ5_A beta-Primeverosidase in complex with disaccharide substrate-analog N-beta-primeverosylamidine, natural aglycone derivative [Camellia sinensis],3WQ5_B beta-Primeverosidase in complex with disaccharide substrate-analog N-beta-primeverosylamidine, natural aglycone derivative [Camellia sinensis],3WQ6_A beta-Primeverosidase in complex with disaccharide substrate-analog N-beta-primeverosylamidine, artificial aglycone derivative [Camellia sinensis],3WQ6_B beta-Primeverosidase in complex with disaccharide substrate-analog N-beta-primeverosylamidine, artificial aglycone derivative [Camellia sinensis]
4ATD_A	1.17e-91	40	513	22	506	Crystal structure of native Raucaffricine glucosidase [Rauvolfia serpentina],4ATD_B Crystal structure of native Raucaffricine glucosidase [Rauvolfia serpentina],4ATL_A Crystal structure of Raucaffricine glucosidase in complex with Glucose [Rauvolfia serpentina],4ATL_B Crystal structure of Raucaffricine glucosidase in complex with Glucose [Rauvolfia serpentina]
4GXP_A	1.25e-91	40	524	13	466	Chimeric Family 1 beta-glucosidase made with non-contiguous SCHEMA [Thermotoga maritima MSB8],4GXP_B Chimeric Family 1 beta-glucosidase made with non-contiguous SCHEMA [Thermotoga maritima MSB8],4GXP_C Chimeric Family 1 beta-glucosidase made with non-contiguous SCHEMA [Thermotoga maritima MSB8]
3ZJ6_A	2.43e-91	40	513	22	506	Crystal of Raucaffricine Glucosidase in complex with inhibitor [Rauvolfia serpentina],3ZJ6_B Crystal of Raucaffricine Glucosidase in complex with inhibitor [Rauvolfia serpentina],4A3Y_A Crystal structure of Raucaffricine glucosidase from ajmaline biosynthesis pathway [Rauvolfia serpentina],4A3Y_B Crystal structure of Raucaffricine glucosidase from ajmaline biosynthesis pathway [Rauvolfia serpentina]
3U57_A	3.24e-91	40	513	22	506	Structures of Alkaloid Biosynthetic Glucosidases Decode Substrate Specificity [Rauvolfia serpentina],3U57_B Structures of Alkaloid Biosynthetic Glucosidases Decode Substrate Specificity [Rauvolfia serpentina],3U5U_A Structures of Alkaloid Biosynthetic Glucosidases Decode Substrate Specificity [Rauvolfia serpentina],3U5U_B Structures of Alkaloid Biosynthetic Glucosidases Decode Substrate Specificity [Rauvolfia serpentina],3U5Y_A Structures of Alkaloid Biosynthetic Glucosidases Decode Substrate Specificity [Rauvolfia serpentina],3U5Y_B Structures of Alkaloid Biosynthetic Glucosidases Decode Substrate Specificity [Rauvolfia serpentina],4EK7_A High speed X-ray analysis of plant enzymes at room temperature [Rauvolfia serpentina],4EK7_B High speed X-ray analysis of plant enzymes at room temperature [Rauvolfia serpentina]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9C525|BGL21_ARATH	1.06e-95	36	515	37	507	Beta-glucosidase 21 OS=Arabidopsis thaliana OX=3702 GN=BGLU21 PE=1 SV=1
sp|Q9FLU8|BGL32_ARATH	2.14e-94	40	515	37	506	Beta-glucosidase 32 OS=Arabidopsis thaliana OX=3702 GN=BGLU32 PE=2 SV=2
sp|Q9C8Y9|BGL22_ARATH	4.52e-94	24	515	15	507	Beta-glucosidase 22 OS=Arabidopsis thaliana OX=3702 GN=BGLU22 PE=1 SV=1
sp|O64883|BGL26_ARATH	9.28e-93	40	516	19	490	Beta-glucosidase 26, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=BGLU26 PE=1 SV=1
sp|Q9FLU9|BGL31_ARATH	2.52e-92	40	519	37	510	Beta-glucosidase 31 OS=Arabidopsis thaliana OX=3702 GN=BGLU31 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000420	0.999551	CS pos: 20-21. Pr: 0.9723

TMHMM  Annotations     

Start	End
557	576