CAZyme Information: PYU1_T013005-p1

Basic Information

• Species: Globisporangium ultimum
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium ultimum
• CAZyme ID: PYU1_T013005-p1
• CAZy Family: GT71
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
962		107966.25	6.1281

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GultimumDAOMBR144	15430	431595	140	15290

• Gene Location: location=PultDAOMBR144_SC1368:262895-265783(+)

Full Sequence      

MLLLTLVSALLLLHDQDSTRIVGASVAPSPSGRLDAPSRHHVELSQHSEPDPSAYGPNTS
SPRTRWSRIRYPLDGSVNVNPVAFRCEFTSDNFADFQRQTASALLCVEVDHKWIQCQPVG
QAPSEFPELPAGDHTAVAFLTAREQGARSNESEAITFTILTPTEYERYVEGRKGQEREAY
ALPEEQDLLTWAANHNSIEEAHVHWNGDMMRDARVSFQQSLPDPLILLIGIKTSVISGFA
QRQAIRSTWASASAFPKHAKLFFVGCQPVLSNSDPRSEETADNSNAELLRAIEKEKHTYG
DLLTNELACQDSYFALVDKVKAFMHFAVTQFPTAQYVMIADDDIYLRTDQLVRVLQVHGP
RSRVYVGQVWAKQFMTPMYSMRSPTHKNYLPEEQYPMSELPPFAFGPHYFISMDCAAFIA
DNRDELRGLAALDDVSVALWLLALQVHPEHIEHFQNLRDTPCTEGLISLADLSPSAIRII
HANLHADAPFCRGVDLTTWRKVERPFRAAETKRKFTVTTKTAMHTNGLQVTTTFTIDSAG
SIEFAYSPSRESVEQHAAAICEHLQPSLVYKFDCSSDVTPKVHSSMAASLEHTMENRETN
PAFLGLWIHNLQLFRADATVPAPAAKIVVYSRNAMFSKTLLECLFASVYTLNPVFVVDET
TFHQHPEYQGVSPDVVVFSILDGSCWSGWDPRCRQAAADYVQLYGSTSLLVMLSGEAWDV
DGLDDSVLLISTVAHVPRRKHVYIPMASLSFGERLIQSPLLLLANTDSGPSSLLEEPQSQ
LTHRKFCAYMYARCDRPQREYMFDLLSTMEPVDALGACQGSSRAPNEKRWTGRSSIWYND
DAVRLYSQYKFVIAFENGQRPGYVTEKLVNAFLAGSVPIYFGHSESVAQVFNPESFIDCG
RFAMLRECAAFVIEVHRSPAKYTRMARAPVIANVSLFHELFSWHPDIPSSHLSDRIREFL
LK

Enzyme Prediction     

EC	2.4.1.122:14	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT31	241	450	6.7e-37	0.984375
GT10	776	928	2.3e-36	0.4092219020172911

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
250845	Galactosyl_T	4.62e-29	240	452	1	196	Galactosyltransferase. This family includes the galactosyltransferases UDP-galactose:2-acetamido-2-deoxy-D-glucose3beta-galactosyltransferase and UDP-Gal:beta-GlcNAc beta 1,3-galactosyltranferase. Specific galactosyltransferases transfer galactose to GlcNAc terminal chains in the synthesis of the lacto-series oligosaccharides types 1 and 2.
395683	Glyco_transf_10	2.54e-15	798	924	17	132	Glycosyltransferase family 10 (fucosyltransferase) C-term. This is the C-terminal domain of a family of fucosyltransferases. This enzyme transfers fucose from GDP-Fucose to GlcNAc in an alpha1,3 linkage. This family is known as glycosyltransferase family 10. The C-terminal domain is the likely binding-region for ADP (manuscript in publication).
215596	PLN03133	9.93e-12	216	462	376	619	beta-1,3-galactosyltransferase; Provisional
178735	PLN03193	6.65e-09	226	452	140	349	beta-1,3-galactosyltransferase; Provisional
140237	PTZ00210	6.22e-04	311	375	177	240	UDP-GlcNAc-dependent glycosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWP29999.1|GT10	5.79e-18	743	929	84	265
QQR32886.1|GT10	5.79e-18	786	915	128	251
QWP06209.1|GT10	5.79e-18	743	929	84	265
ANU61948.1|GT10	5.79e-18	786	915	128	251
ASB35439.1|GT10	5.79e-18	786	915	128	251

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2NZW_A	1.22e-14	778	925	174	307	Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori],2NZW_B Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori],2NZW_C Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori],2NZX_A Crystal Structure of alpha1,3-Fucosyltransferase with GDP [Helicobacter pylori],2NZX_B Crystal Structure of alpha1,3-Fucosyltransferase with GDP [Helicobacter pylori],2NZX_C Crystal Structure of alpha1,3-Fucosyltransferase with GDP [Helicobacter pylori],2NZY_A Crystal Structure of alpha1,3-Fucosyltransferase with GDP-fucose [Helicobacter pylori],2NZY_B Crystal Structure of alpha1,3-Fucosyltransferase with GDP-fucose [Helicobacter pylori],2NZY_C Crystal Structure of alpha1,3-Fucosyltransferase with GDP-fucose [Helicobacter pylori]
5ZOI_A	9.67e-14	778	925	174	307	Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori],5ZOI_B Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5UQ63|YR654_MIMIV	7.32e-17	772	884	405	522	Putative fucosyltransferase R654 OS=Acanthamoeba polyphaga mimivirus OX=212035 GN=MIMI_R654 PE=3 SV=1
sp|Q7JK26|B3GT1_PANTR	2.09e-15	239	456	91	282	Beta-1,3-galactosyltransferase 1 OS=Pan troglodytes OX=9598 GN=B3GALT1 PE=3 SV=1
sp|Q7JK24|B3GT1_GORGO	2.09e-15	239	456	91	282	Beta-1,3-galactosyltransferase 1 OS=Gorilla gorilla gorilla OX=9595 GN=B3GALT1 PE=3 SV=1
sp|Q7JK25|B3GT1_PANPA	2.09e-15	239	456	91	282	Beta-1,3-galactosyltransferase 1 OS=Pan paniscus OX=9597 GN=B3GALT1 PE=3 SV=1
sp|Q9MYM7|B3GT1_PONPY	2.09e-15	239	456	91	282	Beta-1,3-galactosyltransferase 1 OS=Pongo pygmaeus OX=9600 GN=B3GALT1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.347118	0.652867	CS pos: 23-24. Pr: 0.2530

TMHMM  Annotations     

There is no transmembrane helices in PYU1_T013005-p1.