CAZyme Information: PYU1_T012311-p1

Basic Information

• Species: Globisporangium ultimum
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium ultimum
• CAZyme ID: PYU1_T012311-p1
• CAZy Family: GT60
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
511		56634.92	5.4716

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GultimumDAOMBR144	15430	431595	140	15290

• Gene Location: location=PultDAOMBR144_SC2011:284190-285907(+)

Full Sequence      

MSTSDAFLECRQPNYVAKNGKIYAVDPADTTVETEIKIKGVAWSGMEKDNMIPDGLWGTT
SNNKEGVQATTVSKVLQFMTNNSFNSVRLPLNAEFVTNDPLPQIAYIHAYENREITTWDD
PNKVRYLDLIGRMIQTFQNVYATVLLDIHILDKYEEDAYWYTAPYVNITESGTYKAVSYL
ASSLCNAGHWNVIGVDIKNEMLEVQWNEAGDSNIKNDWKQAAEVLANRIVELCPQWLVFI
GGASSPTEFQRFRVSEDYTELSNHWNGGNFKNATKNSIKMAVDNKLVYAPHAHSHGVLPQ
NYFYTATSNCSETTKADAFKGDAAKSECVEFVDGQKTTTLLKCSKSQFSCKSYAHLPVTE
LVTQYKKVMNEAVGSLQAEGKTMVLGSFSGVYGSGQPQQTAILDYLIEYAANIQGGYFWA
LNPDSEYYLEDSIDKKKGIFGRTHYGVMKTTSWQQAHEDLLQALAKMPSSDIPCYGGVAK
KAPGASAATTLKPNSIAVVTIVAAVLVMFAI

Enzyme Prediction     

No EC number prediction in PYU1_T012311-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	33	319	1.5e-67	0.7674418604651163

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	5.88e-13	15	310	28	292	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	1.27e-04	50	309	12	211	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA26601.1|GH5_20	7.04e-65	10	481	142	570
CCA19804.1|GH5_20	5.42e-60	10	475	111	521
ABL75347.1|GH5_20	6.03e-55	4	478	138	569
ABL75352.1|GH5_20	1.23e-53	10	475	164	577
CCA27479.1|GH5_20	1.24e-52	10	497	153	602

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VVG_A	6.14e-21	15	425	8	350	The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_B The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_C The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3W6L_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]
3W6M_A	1.12e-20	15	425	8	350	Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6M_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6M_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]
2ZUM_A	1.24e-20	15	425	41	383	Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_A Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_B Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_C Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3]
3QHM_A	1.24e-20	15	425	41	383	Crystal analysis of the complex structure, E342A-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHM_B Crystal analysis of the complex structure, E342A-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHM_C Crystal analysis of the complex structure, E342A-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii]
3AXX_A	1.66e-20	15	425	41	383	Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],3AXX_B Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],3AXX_C Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P10474|GUNB_CALSA	3.05e-18	38	304	647	902	Endoglucanase/exoglucanase B OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=celB PE=3 SV=1
sp|P23548|GUN_PAEPO	1.17e-13	35	303	53	285	Endoglucanase OS=Paenibacillus polymyxa OX=1406 PE=3 SV=2
sp|P50400|GUND_CELFI	4.46e-09	35	303	60	316	Endoglucanase D OS=Cellulomonas fimi OX=1708 GN=cenD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000080	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PYU1_T012311-p1.