CAZyme Information: PYU1_T012217-p1

Basic Information

• Species: Globisporangium ultimum
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium ultimum
• CAZyme ID: PYU1_T012217-p1
• CAZy Family: GT59
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
752	PultDAOMBR144_SC1991|CGC3	84267.80	6.4746

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GultimumDAOMBR144	15430	431595	140	15290

• Gene Location: location=PultDAOMBR144_SC1991:204261-206519(-)

Full Sequence      

MACAGGDARLPAVDATFQEPLLQIVCFSMDRVFQLSEYLRTLHNHLTLHGTTLRDAAFAR
VAVICRCSTQEIREYYDALAREYATHVAFLYESEQQSFADCLLLSIANGGVSKDHDGMGQ
GARANACKYVMFTVDDAFFFNDVELADAFSFLDGGVRSADTAPDAQKKHTDAWPFAFHVK
LAPSIWRSHLTNKPMLPLPPMHTVVTPHTFADDEVVCEPQPPTVPFKLAYHVFNPARGCL
DWNYPWELSGSVYLHSTVQRVITEIQAAFGKQGINHPNHLELRGHQIVQKWAATKLECAC
PLQPKMHVFAINQVQDVFSNRLYEDEVEANGYAGRGDLTNLLRLYQANETLDEAFYRRNR
LSSVHIGTLVLKAKDSPVAACEESSDLISVVMPVHNVDKYIEQALVSVMTQTYTHLEILV
IDDASTDATPEVVTRLRNQDPRIQYVRNETNIGVAASLNKGFTLAKGKYVARMDGDDISL
PDRIERQWNYLQEHPDVSIVGTSVLLLRERDDDSLRSMQRLETAVYPTSPLVTKWRMLFG
CFVAHPSVMLRHQVLETLARHGEACYSSSQTSSEDYELWLRCLFHHKLRIQSMGDALLIH
RKHASNVSTTRRDRQIEETQIIAARVIQSIVATTSKVDGVFGSSSPNLHRVLHPLFDVDA
CESVDALQHAIKVLQQLQSTVCSTPKALTTKTQIEAFECETEAILQDAAAREGQLALQAM
LLDPIRGTQLWGAFAARHPQVSRAAFQRLVGK

Enzyme Prediction     

No EC number prediction in PYU1_T012217-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT74	22	361	2.3e-64	0.9678571428571429
GT2	389	503	2.5e-33	0.6764705882352942

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395426	Glycos_transf_2	1.70e-36	389	555	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
132997	Glyco_tranf_GTA_type	2.91e-35	390	508	1	120	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
133055	GT_2_WfgS_like	4.30e-29	389	587	1	181	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
133038	GT2_AmsE_like	5.08e-28	389	601	1	201	GT2_AmsE_like is involved in exopolysaccharide amylovora biosynthesis. AmsE is a glycosyltransferase involved in exopolysaccharide amylovora biosynthesis in Erwinia amylovora. Amylovara is one of the three exopolysaccharide produced by E. amylovora. Amylovara-deficient mutants are non-pathogenic. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
223539	WcaA	2.12e-26	384	564	1	169	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA24176.1|GT2|GT74	2.86e-148	22	751	3	728
QOV89439.1|GT2	9.60e-45	385	631	8	239
AOW99803.1|GT2	1.19e-43	387	625	9	234
UFH42939.1|GT2	2.83e-43	382	613	10	228
BBM62240.1|GT2	6.71e-42	382	653	3	248

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	2.10e-15	383	499	2	118	CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]
3BCV_A	2.65e-13	388	494	7	112	Crystal structure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3BCV_B Crystal structure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]
1H7L_A	8.97e-12	388	556	3	169	dTDP-MAGNESIUM COMPLEX OF SPSA FROM BACILLUS SUBTILIS [Bacillus subtilis],1H7Q_A dTDP-MANGANESE COMPLEX OF SPSA FROM BACILLUS SUBTILIS [Bacillus subtilis],1QG8_A Native (Magnesium-Containing) Spsa From Bacillus Subtilis [Bacillus subtilis],1QGQ_A Udp-manganese Complex Of Spsa From Bacillus Subtilis [Bacillus subtilis],1QGS_A Udp-Magnesium Complex Of Spsa From Bacillus Subtilis [Bacillus subtilis]
2Z87_A	1.04e-11	372	485	360	472	Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GalNAc and UDP [Escherichia coli],2Z87_B Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GalNAc and UDP [Escherichia coli]
2Z86_A	1.05e-11	372	485	361	473	Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_B Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_C Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_D Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q58457|Y1057_METJA	3.91e-24	382	583	4	195	Uncharacterized glycosyltransferase MJ1057 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1057 PE=3 SV=2
sp|P71054|EPSE_BACSU	3.48e-23	384	597	3	203	Putative glycosyltransferase EpsE OS=Bacillus subtilis (strain 168) OX=224308 GN=epsE PE=2 SV=2
sp|Q54QG0|PGFB_DICDI	8.08e-23	17	371	465	768	Bifunctional glycosyltransferase pgtA OS=Dictyostelium discoideum OX=44689 GN=pgtA PE=1 SV=1
sp|Q57287|Y1578_HAEIN	8.09e-23	383	622	2	236	Uncharacterized glycosyltransferase HI_1578 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1578 PE=3 SV=1
sp|Q4KXC9|WBNJ_ECOLX	3.72e-21	386	611	7	216	O-antigen biosynthesis glycosyltransferase WbnJ OS=Escherichia coli OX=562 GN=wbnJ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000057	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PYU1_T012217-p1.