CAZyme Information: PYU1_T011841-p1

Basic Information

• Species: Globisporangium ultimum
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium ultimum
• CAZyme ID: PYU1_T011841-p1
• CAZy Family: GT49
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
693		77158.88	5.6167

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GultimumDAOMBR144	15430	431595	140	15290

• Gene Location: location=PultDAOMBR144_SC2040:289362-291443(-)

Full Sequence      

MLRSAVLSVLLATAALSAPLAVAQDASAAPTAAATPAPTTAPRDAKFYWDNEPDPRFAAT
SGEFKDFKPHDETQTCTHDAHATPFNKQVRGVNLGGWLVLEPYIAPSLFYQFLSTQERFG
DKAPEKTAMDQYTFCTALGPEEANRQLRIHWANWVTEADIKELADAGVNSLRVPVGDWMF
TPYEPYIGCTDGAVEELDRLAELALKYDMDILLDIHGLVGSQNGFDNSGKSSTVKWTSIA
STQPIGSTTFEHWPIRTAEWVGTFDAVNHNYSSINYNNLNQSLTAVTEIITRYANNPAIL
GLQPVNEPWELTPMDVLKEYYWKSYKRVKALAPHWKFVIHDSFRFGVQYWSTFMKGCPDI
ALDTHIYQAWNNPGTEADFFSNACQQKYTINTMETLMPIIIGEWSLATDNCLMWLNGFND
NLPGFPKVACKLEKCPIESSYLGKGFPGTPLDLTKPIQGPYGTGVSGPSFGKCPVSSDNA
FEQEDDAVFTRKLNMKKLNAFAVGHGWYFWNFKTEIGTRWNFLALARQGAFPKNVSAYDE
KDGVYSACEQEDKGEFLCAAKRGVKPFQLENGLAYACNAPGVDCTDLDSRFPTLEERCDW
AFNEFWHLNLETGATCDFGGAAHLINDPEKRYHRHKIFTHRDSAGNLTTGSLVARIVFSI
LGVAALGAAGVAFYRWRQRRARQSGFSPINSSA

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	146	422	1.4e-163	0.9964028776978417

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	1.32e-27	89	547	18	399	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
197867	X8	1.39e-13	558	628	3	78	Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges.
400371	X8	2.47e-08	558	623	3	76	X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains.
395098	Cellulase	0.005	151	241	19	115	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAS04784.1|CBM43|GH5_33	0.0	43	677	64	714
EGZ13975.1|CBM43|GH5_33	0.0	44	691	60	695
EEY55816.1|CBM43|GH5_33	0.0	43	689	43	685
UIZ25532.1|CBM43|GH5_33	0.0	44	689	48	700
AAM18483.1|CBM43|GH5_33	0.0	44	693	86	745

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EQP_A	3.88e-54	86	536	6	383	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
1CZ1_A	1.42e-53	86	536	6	383	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
2PB1_A	1.65e-53	86	536	12	389	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]
3O6A_A	3.08e-53	86	536	11	388	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
2PBO_A	4.36e-53	86	536	12	389	Chain A, Hypothetical protein XOG1 [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q96V64|EXG_BLUGR	6.35e-55	86	537	34	409	Glucan 1,3-beta-glucosidase OS=Blumeria graminis OX=34373 PE=3 SV=1
sp|A2RAR6|EXGA_ASPNC	4.86e-54	89	532	42	403	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=exgA PE=3 SV=1
sp|P29717|EXG1_CANAL	4.13e-53	86	536	50	427	Glucan 1,3-beta-glucosidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=XOG1 PE=1 SV=5
sp|Q5B5X8|EXGA_EMENI	1.32e-52	70	536	13	395	Probable glucan 1,3-beta-glucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgA PE=3 SV=2
sp|Q875R9|EXG_LACK1	3.69e-50	89	536	48	429	Glucan 1,3-beta-glucosidase OS=Lachancea kluyveri (strain ATCC 58438 / CBS 3082 / BCRC 21498 / NBRC 1685 / JCM 7257 / NCYC 543 / NRRL Y-12651) OX=226302 GN=EXG1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000423	0.999558	CS pos: 23-24. Pr: 0.9752

TMHMM  Annotations     

Start	End
652	674