CAZyme Information: PYU1_T011367-p1

Basic Information

• Species: Globisporangium ultimum
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium ultimum
• CAZyme ID: PYU1_T011367-p1
• CAZy Family: GT48
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1515	PultDAOMBR144_SC1297|CGC1	171266.07	5.8231

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GultimumDAOMBR144	15430	431595	140	15290

• Gene Location: location=PultDAOMBR144_SC1297:84679-89226(+)

Full Sequence      

MLATRTYSVKVEMHRQLGLDSRLRPCGADAETWAVFYSEKQCVEAVACTASELDAVFAGE
KTAEQTCVAAGVNDVEQTIDHKYPQSLSVGKTAILYGLMGMPGFYDFHNVLKARAESNEV
QYILRHFAKNSTLETLLQGYGVALDIKNMEYKTIDDSKKNDGDDDAVDTVDDDEDGDGED
GEEEDVEGFLFNVLVQRHGAIATELKEFRDSLVKQDDQAQEVKAWHLKDLGLAAARDILD
AKHPLKRLQALSQDFPKHAKKLAFSRKPLTDEFREEIERRQMEAVQNGLVNKFLLNGISI
DPTQRSFNIYDFMNTLKEEWSVAKKLVALPLNDSELNTMLAHVRESNQAQKAVRIRVRGT
YEGTAPFYLNNIETDSKTAQWPLDIDQLRRPAWNIIFVRKNMYEYVVVFDPMTSNGRTIL
NQIAFMRMRGAPLQWGLLISSKELMEAKVGKERDALIQRWKFFKVDDRANAWHFAKLLFL
ARAKDAEVAAKEEDPRKQSSNRIVSAFIEGVADEGTTEVTIQHLVTSYVDSAFGLMSRAK
LEEEALYVLRSDEKNDLVLSMTEYIQKKHLPLESSLFNGVLRKNTDVQSEIMSHLGRDQG
VYQAMARNDQLEQDTDFIEELLSTQETYPAYFPIFDTSKNAEDGSKSPQNLLSHDADHKI
ENLLEAHVGHFHALDSLLIPKKQTLLFVVNLGYQAHAGHVYRGVKAVLEDSEKTLRVGVV
PRLDATDGQETSAFVASIIAAVGTSDEESHLRFVMEALNCVMKGKSLESSKTKLTGILNK
LEKEDGFKDKKMLSTLKTIVSGGENLLSDAKKAGFKQLSSLLMGASTRDQLARLYINGFP
IDLPAHSISDEDMAALTEFDSKYRSHAVGKAFVKKSAKLTMDEANKISLDIVKVCDLVDK
YKKAERAGSLDLEDSQLVVRLPGDPALTVSAYLDPLSEASQMISSLLLMLHTQLNATIEL
VLLPSADYAQFPLQRFYRYLFGKTPSLATPSVEFRKLPIKPILTMKIETPEAWNVQIHET
KEDLDNLRVDPDSAVDVKATKTAVFKLESLLVYGQCRDKTFEMYTPPHGLQLVLERDVGT
QRLHRDTLVMRNFGYFQLQATPGVWSLHLARGRATELFEIVDMASDQAVDTTPVQVYDFG
SRLSQLIVRKRKGREHDALLDPEAIKKASKRDVEPIAEDAGILGSYWGSMMSLLGKKSTK
ETVEVNASNAGESAIVAHSNVNKGRTGETIHVFSLATGHLYERFLKIMMSSVLKRTKNPV
TFWLLENFLSPDFKQSIPALRETFGMDIRLVTYKWPNWLRQQTQKQRIIWGYKILFLDVL
FPLGVQKIIYVDADQVVRADLKELWEMDLQGAPYGYTPFCDSRNVGFQFWRQGYWKDHLR
GRPYHISALYVVDLALFRQMAAGDALRATYEQLSADPNSLSNLDQDLPNYMQHQIKIFSL
PQEWLWCDSWCSDESKVQAKTIDLCNNPKHKEPKLDMAKRVISGELFNESWIELDQEIKD
AEAKFFKDSAATPSE

Enzyme Prediction     

EC	2.4.1.-:29

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT24	1230	1475	4.5e-124	0.9959677419354839

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408203	Glyco_transf_24	0.0	1230	1500	1	267	Glucosyltransferase 24. This is the catalytic domain found in UDP-glucose:glycoprotein glucosyltransferase (UGGT). This domain belongs to glucosyltransferase 24 family (GT24) A-type domain. The GT domain displays the expected glycosyltransferase type A (GT-A) fold.
133054	GT8_HUGT1_C_like	3.39e-163	1230	1475	1	248	The C-terminal domain of HUGT1-like is highly homologous to the GT 8 family. C-terminal domain of glycoprotein glucosyltransferase (UGT). UGT is a large glycoprotein whose C-terminus contains the catalytic activity. This catalytic C-terminal domain is highly homologous to Glycosyltransferase Family 8 (GT 8) and contains the DXD motif that coordinates donor sugar binding, characteristic for Family 8 glycosyltransferases. GT 8 proteins are retaining enzymes based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. The non-catalytic N-terminal portion of the human UTG1 (HUGT1) has been shown to monitor the protein folding status and activate its glucosyltransferase activity.
132996	Glyco_transf_8	1.93e-60	1230	1470	1	243	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.
408200	Thioredoxin_13	3.54e-24	222	342	9	124	Thioredoxin-like domain. This is the second out of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).
408199	Thioredoxin_12	3.34e-22	2	131	67	181	Thioredoxin-like domain. This is one of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ20865.1|GT24	0.0	1	1511	105	1666
CCA14500.1|GT24	0.0	2	1505	152	1665
AIG55512.1|GT24	0.0	1	1505	104	1515
AIG56125.1|GT24	0.0	1	1506	106	1506
CAG1838475.1|GT24	1.17e-202	80	1504	235	1624

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NV4_A	3.92e-139	83	1500	152	1446	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TRT_A	5.38e-139	83	1500	152	1446	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
5MU1_A	1.02e-138	83	1500	152	1446	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5MZO_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TRF_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS2_A	8.76e-136	931	1500	660	1212	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_C Chain C, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_D Chain D, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
5H18_A	7.78e-114	1230	1500	5	271	Crystal structure of catalytic domain of UGGT (UDP-glucose-bound form) from Thermomyces dupontii [Thermomyces dupontii],5Y7F_A Crystal structure of catalytic domain of UGGT (UDP-bound form) from Thermomyces dupontii [Thermomyces dupontii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0WL80|UGGG_ARATH	1.42e-189	80	1504	182	1571	UDP-glucose:glycoprotein glucosyltransferase OS=Arabidopsis thaliana OX=3702 GN=UGGT PE=1 SV=1
sp|Q09332|UGGG_DROME	3.68e-189	75	1499	168	1505	UDP-glucose:glycoprotein glucosyltransferase OS=Drosophila melanogaster OX=7227 GN=Uggt PE=1 SV=2
sp|Q9JLA3|UGGG1_RAT	4.06e-181	80	1505	183	1527	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Uggt1 PE=1 SV=2
sp|Q6P5E4|UGGG1_MOUSE	5.64e-181	80	1505	183	1527	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Mus musculus OX=10090 GN=Uggt1 PE=1 SV=4
sp|Q9NYU2|UGGG1_HUMAN	1.63e-179	2	1508	122	1530	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=UGGT1 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000028	0.000023

TMHMM  Annotations     

There is no transmembrane helices in PYU1_T011367-p1.