CAZyme Information: PYU1_T008966-p1

Basic Information

• Species: Globisporangium ultimum
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium ultimum
• CAZyme ID: PYU1_T008966-p1
• CAZy Family: GT1
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
775	PultDAOMBR144_SC1987|CGC1	83228.61	6.5051

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GultimumDAOMBR144	15430	431595	140	15290

• Gene Location: location=PultDAOMBR144_SC1987:434701-437028(-)

Full Sequence      

MFRSWLPAVWCGFVLTSKSLIGAAADQWDAQADSIVNAFTVDDIIGQMTQINIDNLLKTD
GTLDENKVRDYAKLRVGSYLNSPFAGGAKNGKYGWTAKEWRDVMTRIQAVSMANNGGHPI
VFGIDSVHGANYISNAVLFGQQINGAASFNPDLVYEMGRVTGRDTQAAGIPWVFGPILEL
AQNPLWSRTYETFGEDPYLVSVMADSIIRGLQSNSAIAACMKHFVAYSKTPQGHDRDGVS
ISDFDLLNYFVQPFIAAVNAGVMSTMENYIAVNGVPTVSSSKLLRDLLRSDMGFQGVAVT
DWAEINNLVDWHRVAPTQADAVAMALKQTSIDMSMVPYDTQFIDHTKAMLAANPDQLPRL
KESARRVVKMKLKLGLYTTPVPGADNVNLVGSAADVASALELARESIVLLKNQNNVLPLA
ASSSVFLTGHSANDVGYLCGGWSLRWQGYSGNDMFPHGVTVKQGFEKIAGSAVTYFNGLS
ADGSYTAADLATAKSQAAKSAFTVVVMGEGSYTEKPGDIDDLALPAGQIAYVRELASTGT
KVIIVLVGGRPRLLNGLTDSAHAVINAMLPGELGGQAIAEIIYGRVNPSGRLPITYPKDP
ANIMIPYNHRTNTQCANGYCQMQWEFGTGLSYTTFTYSALSLSKTSVSGSSDSLTATITV
TNSGALAGKETVMLFLTQPFRKISVPEVKMLKKFKKVALNAGASTTVTFTLKAADWSVYD
PQIGNGFSQVAEAGDFVVAIKPETDCNVYGTTNNPLCARFRVTAPSFSANAKTEL

Enzyme Prediction     

EC	3.2.1.21:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	115	336	2.6e-61	0.9722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	9.78e-106	119	740	105	750	beta-glucosidase BglX.
224389	BglX	1.08e-65	40	445	2	374	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
178629	PLN03080	4.78e-58	133	711	108	742	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	4.84e-53	40	367	1	313	Glycosyl hydrolase family 3 N terminal domain.
396478	Glyco_hydro_3_C	3.65e-45	407	632	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ29009.1|GH3	0.0	1	762	1	762
CCA27737.1|GH3	9.19e-304	30	760	66	806
UIZ27116.1|GH3	9.78e-302	48	762	1	724
UIZ29613.1|GH3	1.06e-278	1	770	46	827
UIZ29432.1|GH3	2.66e-275	1	770	1	771

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JP0_A	1.02e-122	40	738	25	737	Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus],5JP0_B Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus]
5M6G_A	5.18e-81	31	596	50	587	Crystal structure Glucan 1,4-beta-glucosidase from Saccharopolyspora erythraea [Saccharopolyspora erythraea D]
5Z9S_A	1.36e-69	35	740	31	771	Functional and Structural Characterization of a beta-Glucosidase Involved in Saponin Metabolism from Intestinal Bacteria [Bifidobacterium longum],5Z9S_B Functional and Structural Characterization of a beta-Glucosidase Involved in Saponin Metabolism from Intestinal Bacteria [Bifidobacterium longum]
6R5I_A	1.76e-69	119	740	73	718	Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5O_A	8.75e-69	119	740	73	718	Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5O_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5R_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q23892|GLUA_DICDI	3.17e-141	29	740	77	811	Lysosomal beta glucosidase OS=Dictyostelium discoideum OX=44689 GN=gluA PE=1 SV=2
sp|A7LXU3|BGH3B_BACO1	7.52e-122	40	738	47	759	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1
sp|Q56078|BGLX_SALTY	2.00e-73	29	740	35	750	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
sp|T2KMH0|PLH24_FORAG	2.38e-72	125	740	72	706	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
sp|P33363|BGLX_ECOLI	6.61e-71	29	740	35	750	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.088807	0.911159	CS pos: 25-26. Pr: 0.3821

TMHMM  Annotations     

There is no transmembrane helices in PYU1_T008966-p1.