CAZyme Information: PYU1_T008562-p1

Basic Information

• Species: Globisporangium ultimum
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium ultimum
• CAZyme ID: PYU1_T008562-p1
• CAZy Family: GH81
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1057	PultDAOMBR144_SC2016|CGC2	118979.08	6.7718

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GultimumDAOMBR144	15430	431595	140	15290

• Gene Location: location=PultDAOMBR144_SC2016:152259-155837(+)

Full Sequence      

MKPQRRTTSSLQINALASGAPQAAASPHLMQRPTSPCFLAPQPLESPMTSRKPKTVLIVV
NVLPLVFARNAAGTAWVVEWSSSATSMFYRNLVSETDKYSPLFIGCPEVFVAKSEEAVVE
KQLRAFHCAPVFLDPTVAHRYFQGFCKGVLWPVFHNVVDVYNSAKLTLDEYVVDCEESAG
GDKNKERRESSGTNCWRDPASWNPAAQDKCWSDYCSVNRTFAKRIIESYHDGNLIWIHDF
HFLMLPSYLLRKVRTALVAIYLHAPFPSSEIFRCLAVRTEILRAILCADHIGFLIFEHAR
HFLTSCKRLLGLNYTTSQNGMLVIEYNGRKINISCSHIEPDVSHLHDILEHVDGDEDALS
FKKKIEKHIYDGDNKRKFVIASVDRLEGLTALPLKLRAFDRFLSLHSDKRKSVVLVQIGL
SLDSRPNDYHQTREYVLKFAAEINRRWAPPGELVVYFEEKVKTTCMERMNLWSLSDTYLD
TCVRSGLSLLPFEYIVAQKHKKEHMPDSSWPFGSMVVSEFASYSRILNGCLLVNPWKTDD
IVNALVKATEMNYYERHNRFQLNYKFLVMHSEQKWAERLLSDVESAVCKKQATEARETID
VGFGFDYRVMQFETGFVQLDLDDLVKKCTKSCRRLFVFDYGGTLSWTTSILDEDGAASCH
RNGSVDGVMACSDLGDRKTAFGQSVIRYIDGQVRTPLSDEARDNIRTLCNDPLNIVFVSS
TGRRAELDAEFASIENLNLISDNGFFLKKAGSTQWECLYKGVDLNLDWKDEVKRIMQSFA
ARTNGAYLIVNEVSLIYDYRSCDPEYGEIQSLELYEQLRQVLKKGDATVYRGKGFVEVHQ
FGVNKATAMTLVLSYMKEKVGVPDFVFFAGDDESDELAFKVLLTFAEHESALEHMFTCTV
GMKPSCAKFYVDSVSDILAAVHAIAVRLRLESSRPTLFSKQSYFDQFVAQGPLVSPRFIR
SLSVETDGTELLDALVPPTASEHSIDTFAFPQPPTPTTSAPTPVGPLTSLTSLVPSCLAP
HISSEWVILGAAVGIGCAIGASAISVHEKLRRFKLLS

Enzyme Prediction     

No EC number prediction in PYU1_T008562-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	52	584	8.6e-109	0.9747368421052631

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
177855	PLN02205	7.24e-146	47	925	52	845	alpha,alpha-trehalose-phosphate synthase [UDP-forming]
184712	PRK14501	1.53e-109	56	925	3	724	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
340820	GT20_TPS	5.09e-109	56	584	2	463	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.
395781	Glyco_transf_20	2.25e-104	56	584	3	469	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.
215555	PLN03063	5.82e-103	55	926	12	785	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ27356.1|GT20	3.52e-147	56	943	24	848
CCA19238.1|GT20	2.02e-146	56	917	265	1069
UIZ24099.1|GT20	4.68e-143	56	924	292	1118
AEQ54916.1|GT20	3.47e-123	49	925	57	847
AXH37639.1|GT20	1.49e-122	56	946	61	861

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HVO_A	4.78e-67	56	583	13	474	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_C Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_D Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
5HUV_A	4.65e-64	56	583	6	467	Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314],5HUV_B Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314]
5HVM_A	2.10e-63	56	583	14	474	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVM_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
5HUT_A	2.22e-63	56	583	6	467	Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUT_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUU_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HUU_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HVL_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314],5HVL_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314]
6JBI_A	2.09e-60	56	583	2	462	Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBI_B Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBR_A Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_B Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_D Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_F Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_H Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_K Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_M Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_O Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBW_A Structure of Tps1/UDP complex [Pyricularia oryzae 70-15],6JBW_B Structure of Tps1/UDP complex [Pyricularia oryzae 70-15]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q94AH8|TPS6_ARATH	2.81e-118	45	925	43	851	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6 OS=Arabidopsis thaliana OX=3702 GN=TPS6 PE=1 SV=2
sp|O23617|TPS5_ARATH	1.12e-116	56	925	62	840	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 5 OS=Arabidopsis thaliana OX=3702 GN=TPS5 PE=1 SV=2
sp|Q0WUI9|TPS8_ARATH	1.95e-113	57	948	60	856	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 8 OS=Arabidopsis thaliana OX=3702 GN=TPS8 PE=2 SV=1
sp|Q9LRA7|TPS9_ARATH	3.51e-113	44	949	51	862	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9 OS=Arabidopsis thaliana OX=3702 GN=TPS9 PE=2 SV=1
sp|Q9ZV48|TPS11_ARATH	1.18e-108	52	953	49	855	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 11 OS=Arabidopsis thaliana OX=3702 GN=TPS11 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.998344	0.001668

TMHMM  Annotations     

Start	End
56	78