CAZyme Information: PYU1_T004073-p1

Basic Information

• Species: Globisporangium ultimum
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium ultimum
• CAZyme ID: PYU1_T004073-p1
• CAZy Family: GH17
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
625		70143.09	6.0864

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GultimumDAOMBR144	15430	431595	140	15290

• Gene Location: location=PultDAOMBR144_SC1354:768971-771320(-)

Full Sequence      

MDKKSLLSVLSPQLQALVEASLGVPLQANAPAQPLLKHPESPGFVVKDAFLGSEHAVTVR
DALLALTKTESFHEAKVGHGDHLRNERAVRGDRIHWVKRPSDLNRSDLLHPAILYLMKQV
ESAAYAFKQTNPDLDLRNVTSTQFAIFPGDGSRFVKHTDTYSTAHQDESGTSSSSDGLVR
VLTCVYYLNQDWVPEHEGQLRVYVKGTSTLLMQHWDVAPKLDTLVVFRSLDVEHEVLPTF
YERMAITVWYYGHVAKQPPDPAASIEPQKQQRQNSLEPPPSPSPNILLSKEASLGDARTI
FVGIPSYRDPECRHTVADLLHKATFPDRIHIGIYLQEDENDDTLRHFEEMYPRSQVRVQF
ADYRSAAGPCVARAGMQKLWDGEDFYLQIDSHMRFRAGWDVFLLEQLLLCATPKPILTTY
PLGYTLPNNVSSDRRPTLLCASAFDENGILRQASKTLATISPVPLPSSFWAAGFAFSSAK
VISEVPYDESLRFLFFGEEASMSARLWTSGWDFFTPGESIIYHLWTRSYRRVFQEIEDND
TAVWRTASQRYVKSLLLGGGNNQEPTGSIAAGTYSLGSERSLDAYQQRIGVNFAKQEIQW
EAEWGNLDPIQFELATKSAGVHAPA

Enzyme Prediction     

EC	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT60	299	593	9.9e-91	0.9939393939393939

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
371506	GlcNAc	3.26e-64	299	595	1	351	Glycosyltransferase (GlcNAc). GlcNAc is an enzyme that carries out the first glycosylation step of hydroxylated Skp1, a ubiquitous eukaryotic protein, in the cytoplasm.
404519	2OG-FeII_Oxy_3	2.90e-16	143	251	2	94	2OG-Fe(II) oxygenase superfamily. This family contains members of the 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily.
214780	P4Hc	1.59e-10	61	250	6	164	Prolyl 4-hydroxylase alpha subunit homologues. Mammalian enzymes catalyse hydroxylation of collagen, for example. Prokaryotic enzymes might catalyse hydroxylation of antibiotic peptides. These are 2-oxoglutarate-dependent dioxygenases, requiring 2-oxoglutarate and dioxygen as cosubstrates and ferrous iron as a cofactor.
226274	EGL9	6.25e-09	53	255	52	251	Proline 4-hydroxylase (includes Rps23 Pro-64 3,4-dihydroxylase Tpa1), contains SM-20 domain [Translation, ribosomal structure and biogenesis, Posttranslational modification, protein turnover, chaperones].
379319	2OG-FeII_Oxy_4	3.60e-04	160	250	10	92	2OG-Fe(II) oxygenase superfamily. This family contains members of the 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA15104.1|GT60	6.65e-145	35	612	96	635
BDA44136.1|GT60	1.90e-77	80	605	97	595
CAG4710602.1|GT60	1.91e-67	43	555	70	573
AAK56291.1|GT60|2.4.1.-	1.32e-64	299	544	5	276
UIZ23002.1|GT60	2.26e-59	464	614	15	163

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T8M_A	1.20e-18	40	251	14	227	Prolyl Hydroxylase (PHD) involved in hypoxia sensing by Dictyostelium discoideum [Dictyostelium discoideum],6T8M_B Prolyl Hydroxylase (PHD) involved in hypoxia sensing by Dictyostelium discoideum [Dictyostelium discoideum],6T8M_C Prolyl Hydroxylase (PHD) involved in hypoxia sensing by Dictyostelium discoideum [Dictyostelium discoideum]
6NMQ_A	3.04e-18	43	251	27	212	Hypoxia-Inducible Factor (HIF) Prolyl Hydroxylase 2 (PHD2) in Complex with the Carboxamide Analog JNJ43058171 [Homo sapiens]
3OUI_A	3.04e-18	43	251	27	212	PHD2-R717 with 40787422 [Homo sapiens]
4JZR_A	3.24e-18	43	251	23	208	Structure of Prolyl Hydroxylase Domain-containing Protein (PHD) with Inhibitors [Homo sapiens]
6YW4_A	3.38e-18	11	251	6	217	Chain A, Egl nine homolog 1 [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8T1C6|GNT1_DICDI	3.26e-65	299	535	5	259	[Skp1-protein]-hydroxyproline N-acetylglucosaminyltransferase OS=Dictyostelium discoideum OX=44689 GN=gnt1 PE=1 SV=2
sp|Q86KR9|P4HA_DICDI	1.76e-17	40	251	71	284	Prolyl 4-hydroxylase subunit alpha OS=Dictyostelium discoideum OX=44689 GN=phyA PE=1 SV=1
sp|Q9GZT9|EGLN1_HUMAN	2.74e-16	43	251	206	391	Egl nine homolog 1 OS=Homo sapiens OX=9606 GN=EGLN1 PE=1 SV=1
sp|P59722|EGLN1_RAT	9.68e-16	43	251	121	306	Egl nine homolog 1 (Fragment) OS=Rattus norvegicus OX=10116 GN=Egln1 PE=2 SV=2
sp|Q91YE3|EGLN1_MOUSE	2.29e-15	43	251	183	368	Egl nine homolog 1 OS=Mus musculus OX=10090 GN=Egln1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000039	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PYU1_T004073-p1.